BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120291.Seq (864 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_05_0080 - 22243175-22243226,22243342-22243389,22243485-222435... 29 3.6 06_03_0860 + 25484826-25485758,25486155-25486406 29 6.3 >05_05_0080 - 22243175-22243226,22243342-22243389,22243485-22243540, 22243752-22243819,22244712-22244773,22245166-22245214, 22245818-22245899,22245987-22246064,22246441-22246499, 22246727-22246805,22246946-22247218 Length = 301 Score = 29.5 bits (63), Expect = 3.6 Identities = 16/66 (24%), Positives = 30/66 (45%) Frame = -3 Query: 250 ASYTSAPTPSRASFDNGYSEFCDKQQPNDYLNYYNNPTPDGADTVVSDSETAAASNFLAS 71 A S+ P+ ++ G + QP+ YLN + P+G +V D A +A+ Sbjct: 175 AENASSVLPATKTYHLGLRRDEETLQPSIYLNNLPDKIPEGTRVLVVDPMLATGGTIVAA 234 Query: 70 VNSLTD 53 ++ L + Sbjct: 235 IDLLVE 240 >06_03_0860 + 25484826-25485758,25486155-25486406 Length = 394 Score = 28.7 bits (61), Expect = 6.3 Identities = 16/43 (37%), Positives = 21/43 (48%) Frame = -3 Query: 601 DKGRRANAADHVRSSCPVQGRCYRPQINIYRRLFSYPLTKRVF 473 D+ RRA D S R Y P NI + F +P T++VF Sbjct: 80 DEARRAVLEDQFNSEVAFLSRLYHP--NIVQVSFLFPYTRQVF 120 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,538,578 Number of Sequences: 37544 Number of extensions: 433403 Number of successful extensions: 1063 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1033 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1063 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2420970504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -