BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120290.Seq (840 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF137396-6|AAG41680.1| 316|Homo sapiens HOR5'Beta8 protein. 31 5.2 AK023360-1|BAB14543.1| 696|Homo sapiens protein ( Homo sapiens ... 30 9.1 >AF137396-6|AAG41680.1| 316|Homo sapiens HOR5'Beta8 protein. Length = 316 Score = 31.1 bits (67), Expect = 5.2 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = -3 Query: 640 YGQLVQALIRAVLGFGRRRCRNTTGDHADALFEFRTRFIGL 518 YG ++ ++ G GR++ NT G H A+ + IGL Sbjct: 220 YGLILHTVLGIATGEGRKKALNTCGSHVCAVLAYYVPMIGL 260 >AK023360-1|BAB14543.1| 696|Homo sapiens protein ( Homo sapiens cDNA FLJ13298 fis, clone OVARC1001306, weakly similar to N-MYC PROTO-ONCOGENE PROTEIN. ). Length = 696 Score = 30.3 bits (65), Expect = 9.1 Identities = 14/45 (31%), Positives = 25/45 (55%) Frame = +3 Query: 207 EKISPKPEKLFEESAARFRSIIGDEHTDDNQNRTDPPVTKLAETV 341 E+I PK EK S+A F + +E +D+ +TD + ++ + V Sbjct: 449 EQIQPKQEKKGGRSSADFTVLDLEEDDEDDNEKTDDSIDEIVDVV 493 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 106,382,373 Number of Sequences: 237096 Number of extensions: 2103537 Number of successful extensions: 5560 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5306 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5560 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 10593928420 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -