BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120286.Seq (727 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_34242| Best HMM Match : DnaJ (HMM E-Value=9.2e-30) 69 3e-12 SB_11933| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 3e-12 SB_21898| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_2302| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_13439| Best HMM Match : DnaJ (HMM E-Value=5.9e-24) 60 2e-09 SB_43852| Best HMM Match : DnaJ (HMM E-Value=1.7e-37) 58 5e-09 SB_39063| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 5e-09 SB_49296| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_34890| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) 56 2e-08 SB_16146| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) 56 2e-08 SB_20922| Best HMM Match : RVT_1 (HMM E-Value=0) 56 4e-08 SB_31923| Best HMM Match : DnaJ (HMM E-Value=2.8e-38) 55 7e-08 SB_21966| Best HMM Match : DnaJ (HMM E-Value=5.30001e-40) 54 2e-07 SB_16477| Best HMM Match : DnaJ (HMM E-Value=8.1e-33) 53 2e-07 SB_6887| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_293| Best HMM Match : DnaJ (HMM E-Value=7.6e-37) 50 1e-06 SB_41006| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_2842| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_29448| Best HMM Match : DnaJ (HMM E-Value=0.00022) 48 8e-06 SB_3383| Best HMM Match : DnaJ (HMM E-Value=3.8e-40) 48 1e-05 SB_2261| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_31961| Best HMM Match : EGF (HMM E-Value=0) 46 2e-05 SB_24444| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_58160| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_45438| Best HMM Match : DnaJ (HMM E-Value=4.4e-26) 43 3e-04 SB_59454| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_42340| Best HMM Match : DnaJ (HMM E-Value=3.2e-32) 42 4e-04 SB_56064| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_37512| Best HMM Match : DnaJ (HMM E-Value=1.3e-29) 40 0.003 SB_17567| Best HMM Match : DnaJ (HMM E-Value=0.0007) 39 0.004 SB_56859| Best HMM Match : rve (HMM E-Value=4.8e-35) 37 0.019 SB_3343| Best HMM Match : DnaJ (HMM E-Value=0.067) 36 0.025 SB_16586| Best HMM Match : DnaJ (HMM E-Value=4.9e-10) 35 0.058 SB_21411| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_56788| Best HMM Match : 7tm_1 (HMM E-Value=4e-32) 30 2.2 SB_27229| Best HMM Match : 7tm_1 (HMM E-Value=0.0014) 30 2.2 SB_5194| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_56284| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_407| Best HMM Match : DnaJ (HMM E-Value=0.0039) 29 5.1 SB_32046| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_14156| Best HMM Match : Neuromodulin (HMM E-Value=1) 28 6.7 SB_22798| Best HMM Match : Cadherin (HMM E-Value=0) 28 8.9 >SB_34242| Best HMM Match : DnaJ (HMM E-Value=9.2e-30) Length = 238 Score = 69.3 bits (162), Expect = 3e-12 Identities = 33/71 (46%), Positives = 47/71 (66%), Gaps = 1/71 (1%) Frame = +2 Query: 311 RQFTTSPQFCASHYDVLGVTPKATQNDIKTAYYKLSKVHHPDKSK-DEASIKKFRAITEA 487 R + P ++Y+VLGV+PKA+Q+ IK AYYKLS HHPD+ + + + F+ I EA Sbjct: 61 RCYANKPGSKKNYYNVLGVSPKASQSKIKDAYYKLSMKHHPDRHQGSDKKHEVFQEIAEA 120 Query: 488 YEVLGNIHLKK 520 Y VLGN+ +K Sbjct: 121 YSVLGNLESRK 131 >SB_11933| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 69.3 bits (162), Expect = 3e-12 Identities = 33/71 (46%), Positives = 47/71 (66%), Gaps = 1/71 (1%) Frame = +2 Query: 311 RQFTTSPQFCASHYDVLGVTPKATQNDIKTAYYKLSKVHHPDKSK-DEASIKKFRAITEA 487 R + P ++Y+VLGV+PKA+Q+ IK AYYKLS HHPD+ + + + F+ I EA Sbjct: 61 RCYANKPGSKKNYYNVLGVSPKASQSKIKDAYYKLSMKHHPDRHQGSDKKHEVFQEIAEA 120 Query: 488 YEVLGNIHLKK 520 Y VLGN+ +K Sbjct: 121 YSVLGNLESRK 131 >SB_21898| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1084 Score = 66.1 bits (154), Expect = 3e-11 Identities = 26/53 (49%), Positives = 42/53 (79%) Frame = +2 Query: 347 HYDVLGVTPKATQNDIKTAYYKLSKVHHPDKSKDEASIKKFRAITEAYEVLGN 505 +Y +LGV P A Q +IK AY++L+K +HPD +KD+++ +KF+ ++EAYEVL + Sbjct: 60 YYKILGVPPNANQKEIKKAYFELAKKYHPDTNKDKSASEKFQEVSEAYEVLSD 112 >SB_2302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 445 Score = 60.1 bits (139), Expect = 2e-09 Identities = 23/59 (38%), Positives = 40/59 (67%) Frame = +2 Query: 344 SHYDVLGVTPKATQNDIKTAYYKLSKVHHPDKSKDEASIKKFRAITEAYEVLGNIHLKK 520 +HYDV+ + P ATQ +IK+AYY+LS+++HPD + + ++F +T AY L + ++ Sbjct: 51 NHYDVMKLLPTATQREIKSAYYELSRIYHPDLNSSAEARERFAELTLAYNTLSRLETRR 109 >SB_13439| Best HMM Match : DnaJ (HMM E-Value=5.9e-24) Length = 565 Score = 60.1 bits (139), Expect = 2e-09 Identities = 23/59 (38%), Positives = 40/59 (67%) Frame = +2 Query: 344 SHYDVLGVTPKATQNDIKTAYYKLSKVHHPDKSKDEASIKKFRAITEAYEVLGNIHLKK 520 +HYDV+ + P ATQ +IK+AYY+LS+++HPD + + ++F +T AY L + ++ Sbjct: 198 NHYDVMKLLPTATQREIKSAYYELSRIYHPDLNSSAEARERFAELTLAYNTLSRLETRR 256 >SB_43852| Best HMM Match : DnaJ (HMM E-Value=1.7e-37) Length = 399 Score = 58.4 bits (135), Expect = 5e-09 Identities = 26/53 (49%), Positives = 37/53 (69%) Frame = +2 Query: 347 HYDVLGVTPKATQNDIKTAYYKLSKVHHPDKSKDEASIKKFRAITEAYEVLGN 505 +YD+LG+T AT DIK Y KLS +HPDK+++ ++ KFR EAY+VL + Sbjct: 5 YYDILGLTRSATDADIKKEYRKLSLKYHPDKNQEPSAEVKFRQAAEAYDVLSD 57 >SB_39063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 350 Score = 58.4 bits (135), Expect = 5e-09 Identities = 25/54 (46%), Positives = 38/54 (70%) Frame = +2 Query: 344 SHYDVLGVTPKATQNDIKTAYYKLSKVHHPDKSKDEASIKKFRAITEAYEVLGN 505 ++YD+LGV A+ ++K AY K + +HPDK+KD + +KF+ I EAYEVL + Sbjct: 4 NYYDILGVKKDASDQELKKAYKKQAFKYHPDKNKDPGAEEKFKEIAEAYEVLSD 57 >SB_49296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 966 Score = 56.4 bits (130), Expect = 2e-08 Identities = 26/59 (44%), Positives = 40/59 (67%) Frame = +2 Query: 344 SHYDVLGVTPKATQNDIKTAYYKLSKVHHPDKSKDEASIKKFRAITEAYEVLGNIHLKK 520 ++YD+L V P AT +IK +Y KL+ +HPDK+ DE +F+ I++AYEVL + +K Sbjct: 65 AYYDILNVPPTATATEIKKSYRKLALKYHPDKNPDEGD--RFKQISQAYEVLSDEKKRK 121 >SB_34890| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) Length = 386 Score = 56.4 bits (130), Expect = 2e-08 Identities = 28/52 (53%), Positives = 36/52 (69%) Frame = +2 Query: 350 YDVLGVTPKATQNDIKTAYYKLSKVHHPDKSKDEASIKKFRAITEAYEVLGN 505 YD+LGV A+ NDIK AY KL+K HPDK+ D +KF+ IT AYE+L + Sbjct: 7 YDLLGVPQNASDNDIKKAYRKLAKELHPDKNPDTG--EKFKDITFAYEILSD 56 >SB_16146| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) Length = 79 Score = 56.4 bits (130), Expect = 2e-08 Identities = 28/52 (53%), Positives = 36/52 (69%) Frame = +2 Query: 350 YDVLGVTPKATQNDIKTAYYKLSKVHHPDKSKDEASIKKFRAITEAYEVLGN 505 YD+LGV A+ NDIK AY KL+K HPDK+ D +KF+ IT AYE+L + Sbjct: 7 YDLLGVPQNASDNDIKKAYRKLAKELHPDKNPDTG--EKFKDITFAYEILSD 56 >SB_20922| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 576 Score = 55.6 bits (128), Expect = 4e-08 Identities = 26/72 (36%), Positives = 40/72 (55%) Frame = +2 Query: 290 ILVTTFYRQFTTSPQFCASHYDVLGVTPKATQNDIKTAYYKLSKVHHPDKSKDEASIKKF 469 +L T T +Y +LGV A+ IK A+ K++ +HPDK+K + + +KF Sbjct: 8 VLTTAALSILATDLVMAKDYYQILGVPRNASDKQIKKAFRKMAVKYHPDKNKGKDAEEKF 67 Query: 470 RAITEAYEVLGN 505 R + EAYEVL + Sbjct: 68 REVAEAYEVLSD 79 >SB_31923| Best HMM Match : DnaJ (HMM E-Value=2.8e-38) Length = 161 Score = 54.8 bits (126), Expect = 7e-08 Identities = 23/52 (44%), Positives = 38/52 (73%) Frame = +2 Query: 344 SHYDVLGVTPKATQNDIKTAYYKLSKVHHPDKSKDEASIKKFRAITEAYEVL 499 ++Y +LGV A+ +DIK AY + + + HPDK+K+ + +KF+ I+EAY+VL Sbjct: 4 NYYAILGVPRNASDDDIKKAYRRQALIFHPDKNKNSGAEEKFKEISEAYKVL 55 >SB_21966| Best HMM Match : DnaJ (HMM E-Value=5.30001e-40) Length = 351 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/53 (47%), Positives = 36/53 (67%) Frame = +2 Query: 347 HYDVLGVTPKATQNDIKTAYYKLSKVHHPDKSKDEASIKKFRAITEAYEVLGN 505 +Y VL V A+ +DIK AY K + +HPDK+K + +KF+ I+EAYEVL + Sbjct: 5 YYAVLNVDKAASADDIKKAYRKQALKYHPDKNKSPGAEEKFKEISEAYEVLSD 57 >SB_16477| Best HMM Match : DnaJ (HMM E-Value=8.1e-33) Length = 138 Score = 53.2 bits (122), Expect = 2e-07 Identities = 28/58 (48%), Positives = 40/58 (68%), Gaps = 3/58 (5%) Frame = +2 Query: 341 ASHYDVLGVTPKATQNDIKTAYYKLSKVHHPDK---SKDEASIKKFRAITEAYEVLGN 505 A +YD+L V A++ DIK +Y KL+ HPDK +K+EA +KF+ I+EAYEVL + Sbjct: 2 ADYYDILEVPRSASEQDIKKSYRKLALKWHPDKNPQNKEEAE-RKFKEISEAYEVLSD 58 >SB_6887| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 875 Score = 52.8 bits (121), Expect = 3e-07 Identities = 27/59 (45%), Positives = 36/59 (61%), Gaps = 2/59 (3%) Frame = +2 Query: 350 YDVLGVTPKATQNDIKTAYYKLSKVHHPDKSKD--EASIKKFRAITEAYEVLGNIHLKK 520 Y VLG+T ATQ +IK Y KL+ HPD+ +D E + K F I EAYE+L + K+ Sbjct: 796 YRVLGLTEDATQEEIKKRYKKLAMKWHPDRHRDNKEEAQKHFMEIQEAYEILSKLKTKR 854 >SB_293| Best HMM Match : DnaJ (HMM E-Value=7.6e-37) Length = 238 Score = 50.4 bits (115), Expect = 1e-06 Identities = 27/58 (46%), Positives = 36/58 (62%), Gaps = 1/58 (1%) Frame = +2 Query: 350 YDVLGVTPKATQNDIKTAYYKLSKVHHPDKSKDEASI-KKFRAITEAYEVLGNIHLKK 520 Y +LGV A++N IK AY KL+ HPDK+KD+ +KF I AYEVL + +K Sbjct: 27 YAILGVPRDASKNQIKRAYRKLAMKLHPDKNKDDPKAQEKFHDIGAAYEVLADDDQRK 84 >SB_41006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 725 Score = 50.0 bits (114), Expect = 2e-06 Identities = 23/53 (43%), Positives = 38/53 (71%) Frame = +2 Query: 341 ASHYDVLGVTPKATQNDIKTAYYKLSKVHHPDKSKDEASIKKFRAITEAYEVL 499 +++Y+VLGV AT +DI+ AY +L+ +HPD K+ + + F+ ++EAYEVL Sbjct: 3 SNYYEVLGVERNATTDDIRRAYRRLALKYHPD--KNAGTEENFKEVSEAYEVL 53 >SB_2842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 257 Score = 48.4 bits (110), Expect = 6e-06 Identities = 23/55 (41%), Positives = 39/55 (70%), Gaps = 3/55 (5%) Frame = +2 Query: 350 YDVLGVTPKATQNDIKTAYYKLSKVHHP---DKSKDEASIKKFRAITEAYEVLGN 505 YDVLGV+ A++++IK AY K+S HP DK + E + +KF+A++++Y +L + Sbjct: 17 YDVLGVSKTASESEIKRAYRKISLQVHPDRADKGEKEKATRKFQALSKSYCILSD 71 >SB_29448| Best HMM Match : DnaJ (HMM E-Value=0.00022) Length = 118 Score = 48.0 bits (109), Expect = 8e-06 Identities = 18/41 (43%), Positives = 30/41 (73%) Frame = +2 Query: 347 HYDVLGVTPKATQNDIKTAYYKLSKVHHPDKSKDEASIKKF 469 HYDV+ + P AT +IK+AYY+LS+++HPD + + ++F Sbjct: 76 HYDVMKLLPTATLREIKSAYYELSRIYHPDLNSSAEARERF 116 >SB_3383| Best HMM Match : DnaJ (HMM E-Value=3.8e-40) Length = 250 Score = 47.6 bits (108), Expect = 1e-05 Identities = 23/55 (41%), Positives = 37/55 (67%), Gaps = 2/55 (3%) Frame = +2 Query: 347 HYDVLGVTPKATQNDIKTAYYKLSKVHHPDK--SKDEASIKKFRAITEAYEVLGN 505 +Y+VLGV A++ D+K AY + + HPDK + E + +KF+ ++EAYEVL + Sbjct: 5 YYEVLGVPRSASEEDVKKAYRRQALRWHPDKNPTNREHAEEKFKKLSEAYEVLSD 59 >SB_2261| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 572 Score = 46.8 bits (106), Expect = 2e-05 Identities = 24/55 (43%), Positives = 33/55 (60%), Gaps = 2/55 (3%) Frame = +2 Query: 347 HYDVLGVTPKATQNDIKTAYYKLSKVHHPDKSKD--EASIKKFRAITEAYEVLGN 505 HY+VLGV + +K Y KL+ HPDK+ D E S + FR I +AY+VL + Sbjct: 5 HYEVLGVERDVDDSALKKTYRKLALKWHPDKNLDNAEESTRVFREIQQAYDVLSD 59 >SB_31961| Best HMM Match : EGF (HMM E-Value=0) Length = 2813 Score = 46.4 bits (105), Expect = 2e-05 Identities = 22/50 (44%), Positives = 32/50 (64%) Frame = +2 Query: 350 YDVLGVTPKATQNDIKTAYYKLSKVHHPDKSKDEASIKKFRAITEAYEVL 499 Y VLGV ATQ +I+ AY ++S HPD++K++ + KFR + EVL Sbjct: 2485 YQVLGVETTATQAEIRRAYRRISLQLHPDRNKEDDAELKFRKLVAVAEVL 2534 >SB_24444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 268 Score = 44.0 bits (99), Expect = 1e-04 Identities = 20/45 (44%), Positives = 30/45 (66%) Frame = +2 Query: 347 HYDVLGVTPKATQNDIKTAYYKLSKVHHPDKSKDEASIKKFRAIT 481 HY+ LG+ AT++DI AY KL+ + HPDKS S + F+A++ Sbjct: 144 HYERLGIQQGATKDDINRAYKKLAVLIHPDKSVAPGSEEAFKALS 188 >SB_58160| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 42.7 bits (96), Expect = 3e-04 Identities = 21/53 (39%), Positives = 33/53 (62%), Gaps = 1/53 (1%) Frame = +2 Query: 350 YDVLGVTPKATQNDIKTAYYKLSKVHHPDKSKDEA-SIKKFRAITEAYEVLGN 505 Y++L V A+Q +IK+A+ K +K HPD + D+ S K F ++EAY L + Sbjct: 10 YEILDVPKDASQTEIKSAFIKKTKEFHPDVNPDDPDSHKAFIKVSEAYTTLSS 62 >SB_45438| Best HMM Match : DnaJ (HMM E-Value=4.4e-26) Length = 211 Score = 42.7 bits (96), Expect = 3e-04 Identities = 21/53 (39%), Positives = 33/53 (62%), Gaps = 1/53 (1%) Frame = +2 Query: 350 YDVLGVTPKATQNDIKTAYYKLSKVHHPDKSKDEA-SIKKFRAITEAYEVLGN 505 Y++L V A+Q +IK+A+ K +K HPD + D+ S K F ++EAY L + Sbjct: 71 YEILDVPKDASQTEIKSAFIKKTKEFHPDVNPDDPDSHKAFIKVSEAYTTLSS 123 >SB_59454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 285 Score = 42.3 bits (95), Expect = 4e-04 Identities = 21/64 (32%), Positives = 39/64 (60%), Gaps = 6/64 (9%) Frame = +2 Query: 347 HYDVLGVTPKATQNDIKTAYYKLSKVHHPDK----SKDEASI--KKFRAITEAYEVLGNI 508 +Y +L ++ A++++IK AY K + HHPD+ S ++ I K+F+ + EAY +L + Sbjct: 160 YYKILNISKTASEDEIKKAYKKEALKHHPDRHSGASDEQKKIAEKQFKEVNEAYSILSDP 219 Query: 509 HLKK 520 K+ Sbjct: 220 KKKR 223 >SB_42340| Best HMM Match : DnaJ (HMM E-Value=3.2e-32) Length = 264 Score = 42.3 bits (95), Expect = 4e-04 Identities = 21/64 (32%), Positives = 39/64 (60%), Gaps = 6/64 (9%) Frame = +2 Query: 347 HYDVLGVTPKATQNDIKTAYYKLSKVHHPDK----SKDEASI--KKFRAITEAYEVLGNI 508 +Y +L ++ A++++IK AY K + HHPD+ S ++ I K+F+ + EAY +L + Sbjct: 160 YYKILNISKTASEDEIKKAYKKEALKHHPDRHSGASDEQKKIAEKQFKEVNEAYSILSDP 219 Query: 509 HLKK 520 K+ Sbjct: 220 KKKR 223 >SB_56064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 711 Score = 41.1 bits (92), Expect = 9e-04 Identities = 16/39 (41%), Positives = 26/39 (66%) Frame = +2 Query: 329 PQFCASHYDVLGVTPKATQNDIKTAYYKLSKVHHPDKSK 445 P FC +Y++ G++ AT +I+ A+ KL+ HPDK+K Sbjct: 23 PIFCEDYYELFGISRDATSKEIRKAFKKLALRLHPDKNK 61 >SB_37512| Best HMM Match : DnaJ (HMM E-Value=1.3e-29) Length = 291 Score = 39.5 bits (88), Expect = 0.003 Identities = 20/53 (37%), Positives = 31/53 (58%), Gaps = 1/53 (1%) Frame = +2 Query: 344 SHYDVLGVTPKATQNDIKTAYYKLSKVHHPDKSKDEASIKK-FRAITEAYEVL 499 ++YD LGV +T+ +I AY K + HPDK+ D + F +++A EVL Sbjct: 7 NYYDTLGVHKDSTEKEILKAYRKKALKCHPDKNPDNPKASELFHKLSKALEVL 59 >SB_17567| Best HMM Match : DnaJ (HMM E-Value=0.0007) Length = 831 Score = 39.1 bits (87), Expect = 0.004 Identities = 16/30 (53%), Positives = 22/30 (73%) Frame = +2 Query: 350 YDVLGVTPKATQNDIKTAYYKLSKVHHPDK 439 Y +LGV P+A+ +DIK Y KL+ + HPDK Sbjct: 802 YSILGVPPEASDDDIKRQYRKLAVLIHPDK 831 >SB_56859| Best HMM Match : rve (HMM E-Value=4.8e-35) Length = 1671 Score = 36.7 bits (81), Expect = 0.019 Identities = 19/54 (35%), Positives = 30/54 (55%) Frame = +2 Query: 350 YDVLGVTPKATQNDIKTAYYKLSKVHHPDKSKDEASIKKFRAITEAYEVLGNIH 511 Y VL + A+ +I+ Y LSK +HPDK + +KF I +AYE + + + Sbjct: 1250 YAVLEIDRGASVAEIRRQYRSLSKKYHPDKETGDP--RKFMRIAKAYEAVSDFN 1301 >SB_3343| Best HMM Match : DnaJ (HMM E-Value=0.067) Length = 29 Score = 36.3 bits (80), Expect = 0.025 Identities = 15/28 (53%), Positives = 21/28 (75%) Frame = +2 Query: 356 VLGVTPKATQNDIKTAYYKLSKVHHPDK 439 +LGV P+A+ +DIK Y KL+ + HPDK Sbjct: 2 ILGVPPEASDDDIKRQYRKLAVLIHPDK 29 >SB_16586| Best HMM Match : DnaJ (HMM E-Value=4.9e-10) Length = 141 Score = 35.1 bits (77), Expect = 0.058 Identities = 22/57 (38%), Positives = 29/57 (50%), Gaps = 8/57 (14%) Frame = +2 Query: 353 DVLGVTPKATQNDIKTAYYKLSKVHHPDK--------SKDEASIKKFRAITEAYEVL 499 +VLGV P IK AY KL HHPDK E + +K + I +AYE++ Sbjct: 78 NVLGVKPTDDATTIKRAYRKLMSEHHPDKLVAKGLPPEMMEMAKQKAQEIQQAYELI 134 >SB_21411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 32.3 bits (70), Expect = 0.41 Identities = 20/54 (37%), Positives = 27/54 (50%), Gaps = 3/54 (5%) Frame = +2 Query: 347 HYDVLGVTPKATQNDIKTAYYKLSKVHHPDKSKDE---ASIKKFRAITEAYEVL 499 +Y +LG+ + +I AY KL+ HPD K E + K F I A EVL Sbjct: 209 YYKILGLKRNCNKREITKAYRKLAVKWHPDNYKGEDKKKAEKMFIDIAAAKEVL 262 >SB_56788| Best HMM Match : 7tm_1 (HMM E-Value=4e-32) Length = 524 Score = 29.9 bits (64), Expect = 2.2 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = +3 Query: 555 YFSYGIQTRTRTYRSYPKVLQVPCNSQYHTHHGR 656 +F++ ++ R YR+ P+V VP ++ HT R Sbjct: 26 FFAFSVKIHRRLYRNRPEVNWVPIHTNMHTREQR 59 >SB_27229| Best HMM Match : 7tm_1 (HMM E-Value=0.0014) Length = 309 Score = 29.9 bits (64), Expect = 2.2 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = +3 Query: 555 YFSYGIQTRTRTYRSYPKVLQVPCNSQYHTHHGR 656 +F++ ++ R YR+ P+V VP ++ HT R Sbjct: 18 FFAFSVKIHRRLYRNRPEVNWVPIHTNMHTREQR 51 >SB_5194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 29.5 bits (63), Expect = 2.9 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = +1 Query: 601 TLKFYKSHATRNITPTMDGKVPIYDFDSWSN 693 T+KF+ R ++ T DG + +D D+WS+ Sbjct: 95 TVKFFPFKDDRLMSTTSDGTITCWDLDNWSH 125 >SB_56284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 334 Score = 29.1 bits (62), Expect = 3.8 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = -3 Query: 239 FLHGNQIYFLYINTCRV*CFCIEVLSY 159 ++ GN+IY L +N C V F I ++SY Sbjct: 165 YILGNKIYTLIVNVCIVVLFGITIVSY 191 >SB_407| Best HMM Match : DnaJ (HMM E-Value=0.0039) Length = 106 Score = 28.7 bits (61), Expect = 5.1 Identities = 9/22 (40%), Positives = 18/22 (81%) Frame = +2 Query: 383 QNDIKTAYYKLSKVHHPDKSKD 448 ++ I+ AY++L++ +HPDK+ D Sbjct: 83 ESKIRKAYFRLAQKYHPDKNPD 104 >SB_32046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1570 Score = 28.7 bits (61), Expect = 5.1 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = -1 Query: 298 H*NIVSLTEHLQINSVCFRNFFTETKFTFYTSIP 197 H N L L+ +SVC R+ ++FTFY+S+P Sbjct: 1509 HENDPILNTCLKPHSVCLRSREVFSRFTFYSSLP 1542 >SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1580 Score = 28.3 bits (60), Expect = 6.7 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -3 Query: 422 LWKVYSKPFLYRSGSLLV*LQAHHSGW 342 +WK+ + LY++GS +V +SGW Sbjct: 303 VWKIITPKVLYKNGSAVVQWSHRYSGW 329 >SB_14156| Best HMM Match : Neuromodulin (HMM E-Value=1) Length = 462 Score = 28.3 bits (60), Expect = 6.7 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +1 Query: 550 ENTSRMEYKPGPEPTDPTLKFYKSHATRNITPT 648 + T+ Y PGP+ P+ SH T ++T T Sbjct: 61 KQTTEARYAPGPDSPTPSQSTQSSHVTVHVTVT 93 >SB_22798| Best HMM Match : Cadherin (HMM E-Value=0) Length = 3255 Score = 27.9 bits (59), Expect = 8.9 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +3 Query: 576 TRTRTYRSYPKVLQVPCNSQYHTHHG 653 TRTR + YP Q P + HTH G Sbjct: 3121 TRTRAFAPYPPHAQGPSHPISHTHKG 3146 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,977,222 Number of Sequences: 59808 Number of extensions: 488762 Number of successful extensions: 1161 Number of sequences better than 10.0: 43 Number of HSP's better than 10.0 without gapping: 1043 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1148 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1937927537 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -