BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120284.Seq (826 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_30234| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_24939| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_29160| Best HMM Match : E-MAP-115 (HMM E-Value=0.81) 28 8.0 SB_328| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 >SB_30234| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 5222 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/51 (33%), Positives = 25/51 (49%) Frame = +3 Query: 339 CMQINVQTYMPNATIDMRKQPNCIYFRICQYCHLEADVPSPDDHSVYRYLC 491 CM V Y PN+T+ + P+C +C + P P+D S+ YLC Sbjct: 2475 CMPCPVGQYCPNSTVSVGGPPDCHAGYVCTG---GSSTPEPNDPSM-GYLC 2521 >SB_24939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 868 Score = 30.3 bits (65), Expect = 2.0 Identities = 21/75 (28%), Positives = 33/75 (44%), Gaps = 1/75 (1%) Frame = +1 Query: 331 FRLACK-STFRRTCPTPR*ICANNPIVYIFEFANIATWRPTCLRPTIIRCTDTCALRAAR 507 +R C + +R+ CP R P+ + +A++R C P+ R C L R Sbjct: 526 YRKGCPLARYRKDCPLAR-YRKGCPLARYRKGCPLASYRKGC--PSA-RYRKGCPLARYR 581 Query: 508 SGYRPPVGRVWRNGG 552 GY P + + WR G Sbjct: 582 KGYHPELLQTWRRAG 596 >SB_29160| Best HMM Match : E-MAP-115 (HMM E-Value=0.81) Length = 196 Score = 28.3 bits (60), Expect = 8.0 Identities = 9/25 (36%), Positives = 19/25 (76%) Frame = -3 Query: 89 VASQHDYDRDQIKRELNSLRRNVHD 15 ++S+H+ ++D+I+ ELN RR + + Sbjct: 130 MSSKHNQEKDEIREELNETRRKLEE 154 >SB_328| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 334 Score = 28.3 bits (60), Expect = 8.0 Identities = 9/25 (36%), Positives = 19/25 (76%) Frame = -3 Query: 89 VASQHDYDRDQIKRELNSLRRNVHD 15 ++S+H+ ++D+I+ ELN RR + + Sbjct: 130 MSSKHNQEKDEIREELNETRRKLEE 154 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,461,239 Number of Sequences: 59808 Number of extensions: 474920 Number of successful extensions: 1337 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1248 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1336 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2311562737 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -