BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120284.Seq (826 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U53338-7|AAA96195.2| 342|Caenorhabditis elegans Lunapark (membr... 32 0.43 AL021482-2|CAA16339.1| 1003|Caenorhabditis elegans Hypothetical ... 28 9.3 >U53338-7|AAA96195.2| 342|Caenorhabditis elegans Lunapark (membrane protein) homologprotein 1 protein. Length = 342 Score = 32.3 bits (70), Expect = 0.43 Identities = 13/41 (31%), Positives = 18/41 (43%) Frame = +3 Query: 387 MRKQPNCIYFRICQYCHLEADVPSPDDHSVYRYLCVACGTL 509 M PNC IC CH + +P ++ + C CG L Sbjct: 224 MSDGPNCRNALICSICHTHNGMSTPAEYPYISFRCFECGHL 264 >AL021482-2|CAA16339.1| 1003|Caenorhabditis elegans Hypothetical protein Y39A1B.2 protein. Length = 1003 Score = 27.9 bits (59), Expect = 9.3 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +1 Query: 331 FRLACKSTFRRTCPTPR*ICANNPIVYIFE 420 F A S F TP IC +NP+V IF+ Sbjct: 153 FSKALHSLFAPNMTTPEEICVSNPLVEIFK 182 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,295,976 Number of Sequences: 27780 Number of extensions: 356573 Number of successful extensions: 923 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 883 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 923 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 2040452812 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -