BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120283.Seq (816 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT016042-1|AAV36927.1| 501|Drosophila melanogaster LP20978p pro... 175 8e-44 AY060238-1|AAL25277.1| 272|Drosophila melanogaster GH04194p pro... 175 8e-44 AE014134-545|AAF51155.1| 501|Drosophila melanogaster CG17259-PA... 175 8e-44 Y14823-2|CAA75101.1| 322|Drosophila melanogaster seryl-tRNA syn... 66 4e-11 AY119252-1|AAM51112.1| 417|Drosophila melanogaster SD21818p pro... 66 4e-11 AE014297-2015|AAF55175.1| 417|Drosophila melanogaster CG4938-PA... 66 4e-11 AY060374-1|AAL25413.1| 464|Drosophila melanogaster LD24627p pro... 35 0.12 AE014297-3468|AAN13983.1| 464|Drosophila melanogaster CG31133-P... 35 0.12 DQ375985-1|ABD37876.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375984-1|ABD37875.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375983-1|ABD37874.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375982-1|ABD37873.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375981-1|ABD37872.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375980-1|ABD37871.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375979-1|ABD37870.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375978-1|ABD37869.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375976-1|ABD37867.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375975-1|ABD37866.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375974-1|ABD37865.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375973-1|ABD37864.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375972-1|ABD37863.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375971-1|ABD37862.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375970-1|ABD37861.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375969-1|ABD37860.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375968-1|ABD37859.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375967-1|ABD37858.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375965-1|ABD37856.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375964-1|ABD37855.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375963-1|ABD37854.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375962-1|ABD37853.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375961-1|ABD37852.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375960-1|ABD37851.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375959-1|ABD37850.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375958-1|ABD37849.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375957-1|ABD37848.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375956-1|ABD37847.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375953-1|ABD37844.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375952-1|ABD37843.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375951-1|ABD37842.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375950-1|ABD37841.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375949-1|ABD37840.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375948-1|ABD37839.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375947-1|ABD37838.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375946-1|ABD37837.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375945-1|ABD37836.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375944-1|ABD37835.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375943-1|ABD37834.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375942-1|ABD37833.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375941-1|ABD37832.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375940-1|ABD37831.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375939-1|ABD37830.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375938-1|ABD37829.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375937-1|ABD37828.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375936-1|ABD37827.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375935-1|ABD37826.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375934-1|ABD37825.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375933-1|ABD37824.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375932-1|ABD37823.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375931-1|ABD37822.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375930-1|ABD37821.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375929-1|ABD37820.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375928-1|ABD37819.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375927-1|ABD37818.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375926-1|ABD37817.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375925-1|ABD37816.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375924-1|ABD37815.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375922-1|ABD37813.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375921-1|ABD37812.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375920-1|ABD37811.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375919-1|ABD37810.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375918-1|ABD37809.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375917-1|ABD37808.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375916-1|ABD37807.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375915-1|ABD37806.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375914-1|ABD37805.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375913-1|ABD37804.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375911-1|ABD37802.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375910-1|ABD37801.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375909-1|ABD37800.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375908-1|ABD37799.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375907-1|ABD37798.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375906-1|ABD37797.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375904-1|ABD37795.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375903-1|ABD37794.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375902-1|ABD37793.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375901-1|ABD37792.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375900-1|ABD37791.1| 430|Drosophila melanogaster catsup prote... 31 2.5 DQ375899-1|ABD37790.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375898-1|ABD37789.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375897-1|ABD37788.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375896-1|ABD37787.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375895-1|ABD37786.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375894-1|ABD37785.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375893-1|ABD37784.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375892-1|ABD37783.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375891-1|ABD37782.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375890-1|ABD37781.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375889-1|ABD37780.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375888-1|ABD37779.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375887-1|ABD37778.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375886-1|ABD37777.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375885-1|ABD37776.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375884-1|ABD37775.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375883-1|ABD37774.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375882-1|ABD37773.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375881-1|ABD37772.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375880-1|ABD37771.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375879-1|ABD37770.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375878-1|ABD37769.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375877-1|ABD37768.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375876-1|ABD37767.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375875-1|ABD37766.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375874-1|ABD37765.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375873-1|ABD37764.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375872-1|ABD37763.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375871-1|ABD37762.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375870-1|ABD37761.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375869-1|ABD37760.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375868-1|ABD37759.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375867-1|ABD37758.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375866-1|ABD37757.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375865-1|ABD37756.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375864-1|ABD37755.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375863-1|ABD37754.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375862-1|ABD37753.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375861-1|ABD37752.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375860-1|ABD37751.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375859-1|ABD37750.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375858-1|ABD37749.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375856-1|ABD37747.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375855-1|ABD37746.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375854-1|ABD37745.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375853-1|ABD37744.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375852-1|ABD37743.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375851-1|ABD37742.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375850-1|ABD37741.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375849-1|ABD37740.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375848-1|ABD37739.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375847-1|ABD37738.1| 430|Drosophila melanogaster catsup prote... 31 2.5 DQ375846-1|ABD37737.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375845-1|ABD37736.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375844-1|ABD37735.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375843-1|ABD37734.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375842-1|ABD37733.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375841-1|ABD37732.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375840-1|ABD37731.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375838-1|ABD37729.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375837-1|ABD37728.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375836-1|ABD37727.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375835-1|ABD37726.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375833-1|ABD37724.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375832-1|ABD37723.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375831-1|ABD37722.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375830-1|ABD37721.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375829-1|ABD37720.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375828-1|ABD37719.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375827-1|ABD37718.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375826-1|ABD37717.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375825-1|ABD37716.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375824-1|ABD37715.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375823-1|ABD37714.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375822-1|ABD37713.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375821-1|ABD37712.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375820-1|ABD37711.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375819-1|ABD37710.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375818-1|ABD37709.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375817-1|ABD37708.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375816-1|ABD37707.1| 449|Drosophila melanogaster catsup prote... 31 2.5 DQ375815-1|ABD37706.1| 449|Drosophila melanogaster catsup prote... 31 2.5 AY058528-1|AAL13757.1| 449|Drosophila melanogaster LD23513p pro... 31 2.5 AF216584-1|AAF37226.1| 449|Drosophila melanogaster seven transm... 31 2.5 AE014134-3021|AAF53744.1| 449|Drosophila melanogaster CG10449-P... 31 2.5 AY118990-1|AAM50850.1| 618|Drosophila melanogaster LP02703p pro... 29 5.8 AE014296-859|AAF47909.1| 618|Drosophila melanogaster CG11349-PA... 29 5.8 D17550-1|BAA04488.1| 1235|Drosophila melanogaster tyrosine kinas... 29 7.6 AE014296-868|AAF47916.2| 1233|Drosophila melanogaster CG7525-PA ... 29 7.6 >BT016042-1|AAV36927.1| 501|Drosophila melanogaster LP20978p protein. Length = 501 Score = 175 bits (425), Expect = 8e-44 Identities = 80/99 (80%), Positives = 87/99 (87%) Frame = -1 Query: 804 VEEKYLIATSEQPILLSTGMNGFQESSLPIKYAGLSTCFRQEVGSHGRDTRGIFRVHQFE 625 ++EKYLIATSEQPI ESSLPIKYAGLSTCFRQEVGSHGRDTRGIFRVHQFE Sbjct: 264 IDEKYLIATSEQPIAAYHRDEWLPESSLPIKYAGLSTCFRQEVGSHGRDTRGIFRVHQFE 323 Query: 624 KVEQFVLTSPHDNASWQMMDEMINNAEEFCKALGLPYRV 508 KVEQFVLTSPHDN SW+MMDEMI NAE+FC++LG+PYRV Sbjct: 324 KVEQFVLTSPHDNKSWEMMDEMIGNAEQFCQSLGIPYRV 362 Score = 169 bits (410), Expect = 5e-42 Identities = 78/87 (89%), Positives = 82/87 (94%) Frame = -3 Query: 508 VNIVSGALNHAASKKLDLEAWFPGSGAFRELVSCSNCLEYQARRLLVRYGQTKKMNAATE 329 VNIVSGALNHAASKKLDLEAWF GSGA+RELVSCSNCL+YQARRLLVR+GQTKKMNAA + Sbjct: 363 VNIVSGALNHAASKKLDLEAWFGGSGAYRELVSCSNCLDYQARRLLVRFGQTKKMNAAVD 422 Query: 328 YVHMLNATMCATTRVICAILEVHQTRT 248 YVHMLNATMCA TRVICAILE HQT T Sbjct: 423 YVHMLNATMCAATRVICAILETHQTET 449 Score = 51.6 bits (118), Expect = 1e-06 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = -2 Query: 254 EDGIKVPEILKPWLPKQYQELIPFVKPAPIDVE 156 E GIKVPE LK ++P ++Q+ IPFVKPAPID+E Sbjct: 448 ETGIKVPEPLKKYMPAKFQDEIPFVKPAPIDLE 480 >AY060238-1|AAL25277.1| 272|Drosophila melanogaster GH04194p protein. Length = 272 Score = 175 bits (425), Expect = 8e-44 Identities = 80/99 (80%), Positives = 87/99 (87%) Frame = -1 Query: 804 VEEKYLIATSEQPILLSTGMNGFQESSLPIKYAGLSTCFRQEVGSHGRDTRGIFRVHQFE 625 ++EKYLIATSEQPI ESSLPIKYAGLSTCFRQEVGSHGRDTRGIFRVHQFE Sbjct: 35 IDEKYLIATSEQPIAAYHRDEWLPESSLPIKYAGLSTCFRQEVGSHGRDTRGIFRVHQFE 94 Query: 624 KVEQFVLTSPHDNASWQMMDEMINNAEEFCKALGLPYRV 508 KVEQFVLTSPHDN SW+MMDEMI NAE+FC++LG+PYRV Sbjct: 95 KVEQFVLTSPHDNKSWEMMDEMIGNAEQFCQSLGIPYRV 133 Score = 169 bits (410), Expect = 5e-42 Identities = 78/87 (89%), Positives = 82/87 (94%) Frame = -3 Query: 508 VNIVSGALNHAASKKLDLEAWFPGSGAFRELVSCSNCLEYQARRLLVRYGQTKKMNAATE 329 VNIVSGALNHAASKKLDLEAWF GSGA+RELVSCSNCL+YQARRLLVR+GQTKKMNAA + Sbjct: 134 VNIVSGALNHAASKKLDLEAWFGGSGAYRELVSCSNCLDYQARRLLVRFGQTKKMNAAVD 193 Query: 328 YVHMLNATMCATTRVICAILEVHQTRT 248 YVHMLNATMCA TRVICAILE HQT T Sbjct: 194 YVHMLNATMCAATRVICAILETHQTET 220 Score = 51.6 bits (118), Expect = 1e-06 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = -2 Query: 254 EDGIKVPEILKPWLPKQYQELIPFVKPAPIDVE 156 E GIKVPE LK ++P ++Q+ IPFVKPAPID+E Sbjct: 219 ETGIKVPEPLKKYMPAKFQDEIPFVKPAPIDLE 251 >AE014134-545|AAF51155.1| 501|Drosophila melanogaster CG17259-PA protein. Length = 501 Score = 175 bits (425), Expect = 8e-44 Identities = 80/99 (80%), Positives = 87/99 (87%) Frame = -1 Query: 804 VEEKYLIATSEQPILLSTGMNGFQESSLPIKYAGLSTCFRQEVGSHGRDTRGIFRVHQFE 625 ++EKYLIATSEQPI ESSLPIKYAGLSTCFRQEVGSHGRDTRGIFRVHQFE Sbjct: 264 IDEKYLIATSEQPIAAYHRDEWLPESSLPIKYAGLSTCFRQEVGSHGRDTRGIFRVHQFE 323 Query: 624 KVEQFVLTSPHDNASWQMMDEMINNAEEFCKALGLPYRV 508 KVEQFVLTSPHDN SW+MMDEMI NAE+FC++LG+PYRV Sbjct: 324 KVEQFVLTSPHDNKSWEMMDEMIGNAEQFCQSLGIPYRV 362 Score = 169 bits (410), Expect = 5e-42 Identities = 78/87 (89%), Positives = 82/87 (94%) Frame = -3 Query: 508 VNIVSGALNHAASKKLDLEAWFPGSGAFRELVSCSNCLEYQARRLLVRYGQTKKMNAATE 329 VNIVSGALNHAASKKLDLEAWF GSGA+RELVSCSNCL+YQARRLLVR+GQTKKMNAA + Sbjct: 363 VNIVSGALNHAASKKLDLEAWFGGSGAYRELVSCSNCLDYQARRLLVRFGQTKKMNAAVD 422 Query: 328 YVHMLNATMCATTRVICAILEVHQTRT 248 YVHMLNATMCA TRVICAILE HQT T Sbjct: 423 YVHMLNATMCAATRVICAILETHQTET 449 Score = 51.6 bits (118), Expect = 1e-06 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = -2 Query: 254 EDGIKVPEILKPWLPKQYQELIPFVKPAPIDVE 156 E GIKVPE LK ++P ++Q+ IPFVKPAPID+E Sbjct: 448 ETGIKVPEPLKKYMPAKFQDEIPFVKPAPIDLE 480 >Y14823-2|CAA75101.1| 322|Drosophila melanogaster seryl-tRNA synthetase protein. Length = 322 Score = 66.5 bits (155), Expect = 4e-11 Identities = 32/77 (41%), Positives = 46/77 (59%) Frame = -3 Query: 487 LNHAASKKLDLEAWFPGSGAFRELVSCSNCLEYQARRLLVRYGQTKKMNAATEYVHMLNA 308 L A +K D+EAW PG + E+ SCSNC +YQARRL +RY + + + H +N Sbjct: 210 LGAPAYQKYDIEAWMPGRQMWGEISSCSNCTDYQARRLGIRY--RRSADGQILHAHTING 267 Query: 307 TMCATTRVICAILEVHQ 257 T A R++ A+LE +Q Sbjct: 268 TATAIPRLLIALLESYQ 284 Score = 51.2 bits (117), Expect = 2e-06 Identities = 31/94 (32%), Positives = 48/94 (51%) Frame = -1 Query: 789 LIATSEQPILLSTGMNGFQESSLPIKYAGLSTCFRQEVGSHGRDTRGIFRVHQFEKVEQF 610 L TSE + E LP+K +S C+R E S ++ +GI+RVHQF KVE F Sbjct: 112 LSGTSEMALAGFFANKLLSEDQLPLKVTAVSRCYRAET-SGLQEEKGIYRVHQFNKVEMF 170 Query: 609 VLTSPHDNASWQMMDEMINNAEEFCKALGLPYRV 508 + + + S ++E N + + LGL +R+ Sbjct: 171 AICT--EEQSEAELEEFKNIEVDLFRRLGLNFRL 202 >AY119252-1|AAM51112.1| 417|Drosophila melanogaster SD21818p protein. Length = 417 Score = 66.5 bits (155), Expect = 4e-11 Identities = 32/77 (41%), Positives = 46/77 (59%) Frame = -3 Query: 487 LNHAASKKLDLEAWFPGSGAFRELVSCSNCLEYQARRLLVRYGQTKKMNAATEYVHMLNA 308 L A +K D+EAW PG + E+ SCSNC +YQARRL +RY + + + H +N Sbjct: 305 LGAPAYQKYDIEAWMPGRQMWGEISSCSNCTDYQARRLGIRY--RRSADGQILHAHTING 362 Query: 307 TMCATTRVICAILEVHQ 257 T A R++ A+LE +Q Sbjct: 363 TATAIPRLLIALLESYQ 379 Score = 51.2 bits (117), Expect = 2e-06 Identities = 31/94 (32%), Positives = 48/94 (51%) Frame = -1 Query: 789 LIATSEQPILLSTGMNGFQESSLPIKYAGLSTCFRQEVGSHGRDTRGIFRVHQFEKVEQF 610 L TSE + E LP+K +S C+R E S ++ +GI+RVHQF KVE F Sbjct: 207 LSGTSEMALAGFFANKLLSEDQLPLKVTAVSRCYRAET-SGLQEEKGIYRVHQFNKVEMF 265 Query: 609 VLTSPHDNASWQMMDEMINNAEEFCKALGLPYRV 508 + + + S ++E N + + LGL +R+ Sbjct: 266 AICT--EEQSEAELEEFKNIEVDLFRRLGLNFRL 297 >AE014297-2015|AAF55175.1| 417|Drosophila melanogaster CG4938-PA protein. Length = 417 Score = 66.5 bits (155), Expect = 4e-11 Identities = 32/77 (41%), Positives = 46/77 (59%) Frame = -3 Query: 487 LNHAASKKLDLEAWFPGSGAFRELVSCSNCLEYQARRLLVRYGQTKKMNAATEYVHMLNA 308 L A +K D+EAW PG + E+ SCSNC +YQARRL +RY + + + H +N Sbjct: 305 LGAPAYQKYDIEAWMPGRQMWGEISSCSNCTDYQARRLGIRY--RRSADGQILHAHTING 362 Query: 307 TMCATTRVICAILEVHQ 257 T A R++ A+LE +Q Sbjct: 363 TATAIPRLLIALLESYQ 379 Score = 51.2 bits (117), Expect = 2e-06 Identities = 31/94 (32%), Positives = 48/94 (51%) Frame = -1 Query: 789 LIATSEQPILLSTGMNGFQESSLPIKYAGLSTCFRQEVGSHGRDTRGIFRVHQFEKVEQF 610 L TSE + E LP+K +S C+R E S ++ +GI+RVHQF KVE F Sbjct: 207 LSGTSEMALAGFFANKLLSEDQLPLKVTAVSRCYRAET-SGLQEEKGIYRVHQFNKVEMF 265 Query: 609 VLTSPHDNASWQMMDEMINNAEEFCKALGLPYRV 508 + + + S ++E N + + LGL +R+ Sbjct: 266 AICT--EEQSEAELEEFKNIEVDLFRRLGLNFRL 297 >AY060374-1|AAL25413.1| 464|Drosophila melanogaster LD24627p protein. Length = 464 Score = 35.1 bits (77), Expect = 0.12 Identities = 22/75 (29%), Positives = 38/75 (50%), Gaps = 1/75 (1%) Frame = -1 Query: 729 SSLPIKYAGLSTCF-RQEVGSHGRDTRGIFRVHQFEKVEQFVLTSPHDNASWQMMDEMIN 553 S LP++Y + R E +G ++ Q V+ FV T DN + ++ ++N Sbjct: 283 SVLPLRYVCCGRSYNRAEADLYG-PIPSLYTATQTNAVQIFVATQT-DNEADSQLEHILN 340 Query: 552 NAEEFCKALGLPYRV 508 A +F KAL +P+R+ Sbjct: 341 LATDFYKALDIPFRI 355 >AE014297-3468|AAN13983.1| 464|Drosophila melanogaster CG31133-PA protein. Length = 464 Score = 35.1 bits (77), Expect = 0.12 Identities = 22/75 (29%), Positives = 38/75 (50%), Gaps = 1/75 (1%) Frame = -1 Query: 729 SSLPIKYAGLSTCF-RQEVGSHGRDTRGIFRVHQFEKVEQFVLTSPHDNASWQMMDEMIN 553 S LP++Y + R E +G ++ Q V+ FV T DN + ++ ++N Sbjct: 283 SVLPLRYVCCGRSYNRAEADLYG-PIPSLYTATQTNAVQIFVATQT-DNEADSQLEHILN 340 Query: 552 NAEEFCKALGLPYRV 508 A +F KAL +P+R+ Sbjct: 341 LATDFYKALDIPFRI 355 >DQ375985-1|ABD37876.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375984-1|ABD37875.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375983-1|ABD37874.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375982-1|ABD37873.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375981-1|ABD37872.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375980-1|ABD37871.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375979-1|ABD37870.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375978-1|ABD37869.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375976-1|ABD37867.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375975-1|ABD37866.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375974-1|ABD37865.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375973-1|ABD37864.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375972-1|ABD37863.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375971-1|ABD37862.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375970-1|ABD37861.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375969-1|ABD37860.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375968-1|ABD37859.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375967-1|ABD37858.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375965-1|ABD37856.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375964-1|ABD37855.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375963-1|ABD37854.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375962-1|ABD37853.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375961-1|ABD37852.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375960-1|ABD37851.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375959-1|ABD37850.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375958-1|ABD37849.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375957-1|ABD37848.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375956-1|ABD37847.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375953-1|ABD37844.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375952-1|ABD37843.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375951-1|ABD37842.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375950-1|ABD37841.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375949-1|ABD37840.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375948-1|ABD37839.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375947-1|ABD37838.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375946-1|ABD37837.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375945-1|ABD37836.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375944-1|ABD37835.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375943-1|ABD37834.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375942-1|ABD37833.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375941-1|ABD37832.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375940-1|ABD37831.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375939-1|ABD37830.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375938-1|ABD37829.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375937-1|ABD37828.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375936-1|ABD37827.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375935-1|ABD37826.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375934-1|ABD37825.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375933-1|ABD37824.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375932-1|ABD37823.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375931-1|ABD37822.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375930-1|ABD37821.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375929-1|ABD37820.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375928-1|ABD37819.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375927-1|ABD37818.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375926-1|ABD37817.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375925-1|ABD37816.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375924-1|ABD37815.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375922-1|ABD37813.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375921-1|ABD37812.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375920-1|ABD37811.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375919-1|ABD37810.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375918-1|ABD37809.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375917-1|ABD37808.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375916-1|ABD37807.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375915-1|ABD37806.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375914-1|ABD37805.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375913-1|ABD37804.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375911-1|ABD37802.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375910-1|ABD37801.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375909-1|ABD37800.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375908-1|ABD37799.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375907-1|ABD37798.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375906-1|ABD37797.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375904-1|ABD37795.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375903-1|ABD37794.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375902-1|ABD37793.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375901-1|ABD37792.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375900-1|ABD37791.1| 430|Drosophila melanogaster catsup protein protein. Length = 430 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 86 DHDHGHHHHGHDERHTKAKPDLD 108 >DQ375899-1|ABD37790.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375898-1|ABD37789.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375897-1|ABD37788.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375896-1|ABD37787.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375895-1|ABD37786.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375894-1|ABD37785.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375893-1|ABD37784.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375892-1|ABD37783.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375891-1|ABD37782.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375890-1|ABD37781.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375889-1|ABD37780.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375888-1|ABD37779.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375887-1|ABD37778.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375886-1|ABD37777.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375885-1|ABD37776.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375884-1|ABD37775.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375883-1|ABD37774.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375882-1|ABD37773.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375881-1|ABD37772.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375880-1|ABD37771.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375879-1|ABD37770.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375878-1|ABD37769.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375877-1|ABD37768.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375876-1|ABD37767.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375875-1|ABD37766.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375874-1|ABD37765.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375873-1|ABD37764.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375872-1|ABD37763.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375871-1|ABD37762.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375870-1|ABD37761.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375869-1|ABD37760.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375868-1|ABD37759.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375867-1|ABD37758.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375866-1|ABD37757.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375865-1|ABD37756.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375864-1|ABD37755.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375863-1|ABD37754.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375862-1|ABD37753.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375861-1|ABD37752.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375860-1|ABD37751.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375859-1|ABD37750.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375858-1|ABD37749.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375856-1|ABD37747.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375855-1|ABD37746.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375854-1|ABD37745.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375853-1|ABD37744.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375852-1|ABD37743.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375851-1|ABD37742.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375850-1|ABD37741.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375849-1|ABD37740.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375848-1|ABD37739.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375847-1|ABD37738.1| 430|Drosophila melanogaster catsup protein protein. Length = 430 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 86 DHDHGHHHHGHDERHTKAKPDLD 108 >DQ375846-1|ABD37737.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375845-1|ABD37736.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375844-1|ABD37735.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375843-1|ABD37734.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375842-1|ABD37733.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375841-1|ABD37732.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375840-1|ABD37731.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375838-1|ABD37729.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375837-1|ABD37728.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375836-1|ABD37727.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375835-1|ABD37726.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375833-1|ABD37724.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375832-1|ABD37723.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375831-1|ABD37722.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375830-1|ABD37721.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375829-1|ABD37720.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375828-1|ABD37719.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375827-1|ABD37718.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375826-1|ABD37717.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375825-1|ABD37716.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375824-1|ABD37715.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375823-1|ABD37714.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375822-1|ABD37713.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375821-1|ABD37712.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375820-1|ABD37711.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375819-1|ABD37710.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375818-1|ABD37709.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375817-1|ABD37708.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375816-1|ABD37707.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >DQ375815-1|ABD37706.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >AY058528-1|AAL13757.1| 449|Drosophila melanogaster LD23513p protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >AF216584-1|AAF37226.1| 449|Drosophila melanogaster seven transmembrane protein Catecholaminesup protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >AE014134-3021|AAF53744.1| 449|Drosophila melanogaster CG10449-PA protein. Length = 449 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 314 ERDHVRHHQGH-LRHTRSSPDED 249 + DH HH GH RHT++ PD D Sbjct: 105 DHDHGHHHHGHDERHTKAKPDLD 127 >AY118990-1|AAM50850.1| 618|Drosophila melanogaster LP02703p protein. Length = 618 Score = 29.5 bits (63), Expect = 5.8 Identities = 17/47 (36%), Positives = 24/47 (51%) Frame = -2 Query: 317 AERDHVRHHQGHLRHTRSSPDEDGIKVPEILKPWLPKQYQELIPFVK 177 A+ HV+HH+ H RH S ED + L P K+ ++ PF K Sbjct: 7 ADVSHVKHHK-HQRHHHSRDHEDDDEESHYLPPHEEKEVEQ--PFYK 50 >AE014296-859|AAF47909.1| 618|Drosophila melanogaster CG11349-PA protein. Length = 618 Score = 29.5 bits (63), Expect = 5.8 Identities = 17/47 (36%), Positives = 24/47 (51%) Frame = -2 Query: 317 AERDHVRHHQGHLRHTRSSPDEDGIKVPEILKPWLPKQYQELIPFVK 177 A+ HV+HH+ H RH S ED + L P K+ ++ PF K Sbjct: 7 ADVSHVKHHK-HQRHHHSRDHEDDDEESHYLPPHEEKEVEQ--PFYK 50 >D17550-1|BAA04488.1| 1235|Drosophila melanogaster tyrosine kinase protein. Length = 1235 Score = 29.1 bits (62), Expect = 7.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = -2 Query: 389 PSKKIACKVRSDEKDERCH*IRAHAERDHVRHHQGHLRH 273 P KK+ K + D+ ++ H H++HHQ H H Sbjct: 777 PVKKVDSKYQVDDDEDEVD----HQHHQHMQHHQNHQNH 811 >AE014296-868|AAF47916.2| 1233|Drosophila melanogaster CG7525-PA protein. Length = 1233 Score = 29.1 bits (62), Expect = 7.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = -2 Query: 389 PSKKIACKVRSDEKDERCH*IRAHAERDHVRHHQGHLRH 273 P KK+ K + D+ ++ H H++HHQ H H Sbjct: 775 PVKKVDSKYQVDDDEDEVD----HQHHQHMQHHQNHQNH 809 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 37,549,657 Number of Sequences: 53049 Number of extensions: 840410 Number of successful extensions: 2895 Number of sequences better than 10.0: 176 Number of HSP's better than 10.0 without gapping: 2256 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2722 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 3839531124 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -