Bombyx BLAST Result against celegans

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120278.Seq
         (785 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z22181-4|CAA80182.1|  824|Caenorhabditis elegans Hypothetical pr...    30   2.2  

>Z22181-4|CAA80182.1|  824|Caenorhabditis elegans Hypothetical
           protein ZK632.5 protein.
          Length = 824

 Score = 29.9 bits (64), Expect = 2.2
 Identities = 19/68 (27%), Positives = 32/68 (47%), Gaps = 4/68 (5%)
 Frame = +1

Query: 139 RFVAKDIASSLKYVNCERAIRVHVDGKYKSTFEHADQIHTML-QIAWQ---SRATRCICT 306
           R   +D  +SLK V+  + + V +DG+YK        +   + Q+AW    +  TR +  
Sbjct: 93  RLSDEDFENSLKEVSLSQKLMVRIDGEYKYRLYSKPIVRNNIPQLAWDISPALRTRKVAE 152

Query: 307 HTQCSLPN 330
             + S PN
Sbjct: 153 KDEISPPN 160


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,970,318
Number of Sequences: 27780
Number of extensions: 425856
Number of successful extensions: 1092
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1044
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1092
length of database: 12,740,198
effective HSP length: 80
effective length of database: 10,517,798
effective search space used: 1903721438
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)