BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120277.Seq (791 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC3H1.10 |||phytochelatin synthetase |Schizosaccharomyces pomb... 28 1.8 SPBP23A10.06 |||manganese ion transporter |Schizosaccharomyces p... 27 3.1 SPBC2D10.17 |clr1||cryptic loci regulator Clr1|Schizosaccharomyc... 27 3.1 SPAC10F6.10 |||protein kinase, RIO family |Schizosaccharomyces p... 27 3.1 SPAC4D7.05 |sum1|tif34|translation initiation factor eIF3i|Schiz... 26 5.4 SPAC56E4.05 |mug69||DUF788 family protein|Schizosaccharomyces po... 26 7.1 SPBC646.04 |pla1||poly|Schizosaccharomyces pombe|chr 2|||Manual 26 7.1 SPCC4B3.07 |||nuclear pore associated protein|Schizosaccharomyce... 26 7.1 SPAPB1A11.04c |||transcription factor |Schizosaccharomyces pombe... 26 7.1 SPBC25H2.12c |cct7||chaperonin-containing T-complex eta subunit ... 25 9.4 SPBC29A3.17 |gef3||RhoGEF Gef3|Schizosaccharomyces pombe|chr 2||... 25 9.4 SPAC29A4.15 |||serine-tRNA ligase|Schizosaccharomyces pombe|chr ... 25 9.4 SPAC890.04c |||ribosome biogenesis protein Ytm1 |Schizosaccharom... 25 9.4 >SPAC3H1.10 |||phytochelatin synthetase |Schizosaccharomyces pombe|chr 1|||Manual Length = 414 Score = 27.9 bits (59), Expect = 1.8 Identities = 24/74 (32%), Positives = 37/74 (50%), Gaps = 5/74 (6%) Frame = +3 Query: 6 TMNFWATFSICLVGYLVYAGHLNNELQEIKSIL-VVMYESMEKHFSNVVDEIDSL----K 170 TM FWA FS+ ++ + G L+EI+S+L V + + + ++DSL K Sbjct: 345 TMAFWAIFSLPMIQKALPKG----VLEEIQSLLKEVEISEINTQLTALKKQLDSLTHCCK 400 Query: 171 TDTFMMLSNLQNNT 212 TDT S+ NT Sbjct: 401 TDTGCCSSSCCKNT 414 >SPBP23A10.06 |||manganese ion transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 335 Score = 27.1 bits (57), Expect = 3.1 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = -2 Query: 355 YINLVISSVY*TLSRLLTTPFFVNST 278 YIN V + TL+ LLT PF V+ T Sbjct: 247 YINFVSGGISGTLATLLTQPFDVSKT 272 >SPBC2D10.17 |clr1||cryptic loci regulator Clr1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1238 Score = 27.1 bits (57), Expect = 3.1 Identities = 16/47 (34%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = -2 Query: 172 VLRESISS-TTLEKCFSIDSYMTTSIDFISCSSLFKCPAYTK*PTKQ 35 + ++S+SS TTL K S SY+ T+ + + +S FK T P + Sbjct: 544 IQQKSVSSETTLVKPSSTSSYIDTTNNVLKTNSSFKSSGLTSGPRNE 590 >SPAC10F6.10 |||protein kinase, RIO family |Schizosaccharomyces pombe|chr 1|||Manual Length = 521 Score = 27.1 bits (57), Expect = 3.1 Identities = 15/48 (31%), Positives = 21/48 (43%), Gaps = 4/48 (8%) Frame = -1 Query: 236 YNCVPRSNRVILQVAQHHKRVRFKRINFVYHIGKMFF----HRFVHDH 105 Y V R+ R++ V H N +YH GK++F HDH Sbjct: 269 YQLVARNMRILFHVC-HLVHADLSEYNLLYHKGKVYFIDVSQSVEHDH 315 >SPAC4D7.05 |sum1|tif34|translation initiation factor eIF3i|Schizosaccharomyces pombe|chr 1|||Manual Length = 328 Score = 26.2 bits (55), Expect = 5.4 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = +3 Query: 159 DSLKTDTFMMLSNLQNNTIRTWDAVVKNGKKI 254 D K+ T +M+S +NT+R WD VK GK++ Sbjct: 59 DINKSST-LMVSGAADNTMRLWD--VKTGKQL 87 >SPAC56E4.05 |mug69||DUF788 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 192 Score = 25.8 bits (54), Expect = 7.1 Identities = 13/24 (54%), Positives = 17/24 (70%), Gaps = 1/24 (4%) Frame = +3 Query: 441 RHGLH-LSKFKNAFASVSTTFVHH 509 R GL SKF AFAS+S+ F+H+ Sbjct: 39 RSGLSKFSKFVYAFASISSGFLHY 62 >SPBC646.04 |pla1||poly|Schizosaccharomyces pombe|chr 2|||Manual Length = 566 Score = 25.8 bits (54), Expect = 7.1 Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 4/47 (8%) Frame = +3 Query: 462 KFKNAFASVSTTFVHHPS--KH--RKMINDAGGSCHNTVKYMVDIYG 590 K + ++T FV S KH KM N+AGG Y + +YG Sbjct: 49 KVLDELQQITTEFVKKVSLAKHMNEKMANEAGGKIFTYGSYRLGVYG 95 >SPCC4B3.07 |||nuclear pore associated protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 393 Score = 25.8 bits (54), Expect = 7.1 Identities = 9/40 (22%), Positives = 22/40 (55%) Frame = +3 Query: 114 YESMEKHFSNVVDEIDSLKTDTFMMLSNLQNNTIRTWDAV 233 Y + +++ +++D +S D S+ NN++ TW+ + Sbjct: 290 YTTFAEYYMDLLDNSESNVDDLINKASSWLNNSVDTWNVI 329 >SPAPB1A11.04c |||transcription factor |Schizosaccharomyces pombe|chr 1|||Manual Length = 697 Score = 25.8 bits (54), Expect = 7.1 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = -1 Query: 245 AIFYNCVPRSNRVILQVAQHHKRVRFKRI 159 A+ + VPR RVI QV+Q R R K+I Sbjct: 4 AVEKDAVPRKRRVISQVSQACIRCRQKKI 32 >SPBC25H2.12c |cct7||chaperonin-containing T-complex eta subunit Cct7|Schizosaccharomyces pombe|chr 2|||Manual Length = 558 Score = 25.4 bits (53), Expect = 9.4 Identities = 13/50 (26%), Positives = 23/50 (46%) Frame = -3 Query: 510 GGEQKLLKRLQRHF*ILINVIRVDPKNRRVVEHNVIRRLHISKYCSDYMI 361 GG + + ++R I +++ KN VV + +SKY DY + Sbjct: 381 GGADQFIAEVERSLHDAIMIVKHALKNNLVVAGGGACEMELSKYLRDYSL 430 >SPBC29A3.17 |gef3||RhoGEF Gef3|Schizosaccharomyces pombe|chr 2|||Manual Length = 525 Score = 25.4 bits (53), Expect = 9.4 Identities = 7/17 (41%), Positives = 13/17 (76%) Frame = +2 Query: 218 NVGRSCKKWQKNTNLDE 268 N+G+ +KW KN+++ E Sbjct: 181 NIGKKVEKWMKNSSISE 197 >SPAC29A4.15 |||serine-tRNA ligase|Schizosaccharomyces pombe|chr 1|||Manual Length = 450 Score = 25.4 bits (53), Expect = 9.4 Identities = 16/51 (31%), Positives = 23/51 (45%), Gaps = 1/51 (1%) Frame = +3 Query: 75 NELQEIKSILVVMYESMEKHFSNVVDEIDSLKTDTFMMLSNLQNN-TIRTW 224 N L E K L+ + K NVV I ++ D+ + + NN IR W Sbjct: 81 NSLTERKKNLIEQETAKNKEMLNVVSSIGNIVHDSVPVSMDEDNNEIIRKW 131 >SPAC890.04c |||ribosome biogenesis protein Ytm1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 440 Score = 25.4 bits (53), Expect = 9.4 Identities = 12/41 (29%), Positives = 19/41 (46%) Frame = +3 Query: 141 NVVDEIDSLKTDTFMMLSNLQNNTIRTWDAVVKNGKKIPIS 263 N+V + + + +M S +NT R WD +G IS Sbjct: 356 NLVSGLSASPENPYMFASVSHDNTCRVWDVRATSGSIYTIS 396 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,139,357 Number of Sequences: 5004 Number of extensions: 63519 Number of successful extensions: 195 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 190 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 195 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 385381248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -