BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120277.Seq (791 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_3449| Best HMM Match : DUF465 (HMM E-Value=9.2) 31 1.1 SB_2038| Best HMM Match : rve (HMM E-Value=0.0076) 31 1.1 SB_54269| Best HMM Match : M (HMM E-Value=8.1e-20) 30 1.9 SB_11603| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_44472| Best HMM Match : Y_phosphatase (HMM E-Value=0) 29 4.3 SB_13571| Best HMM Match : SNURF (HMM E-Value=2.8) 29 5.7 SB_49936| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_35409| Best HMM Match : Guanylate_cyc (HMM E-Value=1.7e-17) 28 10.0 SB_490| Best HMM Match : C1_1 (HMM E-Value=1.3) 28 10.0 >SB_3449| Best HMM Match : DUF465 (HMM E-Value=9.2) Length = 128 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/47 (29%), Positives = 27/47 (57%) Frame = +3 Query: 111 MYESMEKHFSNVVDEIDSLKTDTFMMLSNLQNNTIRTWDAVVKNGKK 251 M E ++ H N +D +D + + ++NL NN+ +T + + + GKK Sbjct: 1 MIEEID-HLDNEIDNLDLVNKELSKYINNLHNNSAQTANKIDEVGKK 46 >SB_2038| Best HMM Match : rve (HMM E-Value=0.0076) Length = 656 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/47 (29%), Positives = 27/47 (57%) Frame = +3 Query: 111 MYESMEKHFSNVVDEIDSLKTDTFMMLSNLQNNTIRTWDAVVKNGKK 251 M E ++ H N +D +D + + ++NL NN+ +T + + + GKK Sbjct: 577 MIEEID-HLDNEIDNLDLVNKELSKYINNLHNNSAQTANKIDEVGKK 622 >SB_54269| Best HMM Match : M (HMM E-Value=8.1e-20) Length = 3489 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/43 (27%), Positives = 26/43 (60%) Frame = +3 Query: 57 YAGHLNNELQEIKSILVVMYESMEKHFSNVVDEIDSLKTDTFM 185 + HLN + +EI+ + V + + + F N+V+E+ S++ + M Sbjct: 655 FKNHLNEKEKEIEVLKVEIMKLKKHQFDNLVEEVSSVRAELAM 697 >SB_11603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 635 Score = 29.9 bits (64), Expect = 2.5 Identities = 22/76 (28%), Positives = 38/76 (50%), Gaps = 8/76 (10%) Frame = +3 Query: 69 LNNELQE----IKSILVVMYESMEKHFSN----VVDEIDSLKTDTFMMLSNLQNNTIRTW 224 LNN + E +K I V MY ++K + DE+++ D + L + QNNT Sbjct: 507 LNNTVYEGYKFVKPIKVSMYYDVKKLVNANRRVASDEVEAGDIDPVLYLWDKQNNTCFNG 566 Query: 225 DAVVKNGKKIPISTKK 272 + +VK +K+ + K+ Sbjct: 567 EVLVKQKEKVTLPIKR 582 >SB_44472| Best HMM Match : Y_phosphatase (HMM E-Value=0) Length = 206 Score = 29.1 bits (62), Expect = 4.3 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = -1 Query: 602 QNGRSVNVHHVFDRVMTRSARIVDHFSMFRWV 507 QN + +N+HH R+ + +V +F +R+V Sbjct: 161 QNNKRINIHHALVRLRRQRMLLVANFGQYRFV 192 >SB_13571| Best HMM Match : SNURF (HMM E-Value=2.8) Length = 320 Score = 28.7 bits (61), Expect = 5.7 Identities = 17/63 (26%), Positives = 28/63 (44%) Frame = +3 Query: 492 TTFVHHPSKHRKMINDAGGSCHNTVKYMVDIYGASVLILRTPCSFADQLLSTFIANNYLC 671 TT++HHP H K+ A + + ++ I R F +++T N+Y Sbjct: 37 TTYIHHPQDHLKVSFTAREDSNEVFVLLNGSRQLNIPITRDCTEFTRVIITTKPRNSY-- 94 Query: 672 YFY 680 YFY Sbjct: 95 YFY 97 >SB_49936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 526 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/37 (37%), Positives = 17/37 (45%) Frame = -3 Query: 645 CSATGRQTSKAFAKSKRTLRKCPPCI*PCYDTIRPHR 535 C T R + TLR C + PC T+RPHR Sbjct: 240 CRYTLRPCRYTLRPCRYTLRPCGYTLRPCGYTLRPHR 276 >SB_35409| Best HMM Match : Guanylate_cyc (HMM E-Value=1.7e-17) Length = 577 Score = 27.9 bits (59), Expect = 10.0 Identities = 15/65 (23%), Positives = 34/65 (52%) Frame = +3 Query: 48 YLVYAGHLNNELQEIKSILVVMYESMEKHFSNVVDEIDSLKTDTFMMLSNLQNNTIRTWD 227 +L + + ++L+ KS++ +++ + +FS+VV +D T M + L N+ D Sbjct: 413 FLSHFSSVADQLKRGKSVVPELFDEVTIYFSDVVAFMDLASDSTPMEIVTLLNDLYIALD 472 Query: 228 AVVKN 242 ++ N Sbjct: 473 KILAN 477 >SB_490| Best HMM Match : C1_1 (HMM E-Value=1.3) Length = 256 Score = 27.9 bits (59), Expect = 10.0 Identities = 12/33 (36%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = -2 Query: 250 FLPFFTTASHVRI-VLFCKLLNIINVSVLRESI 155 FLPF T +H +FC++L + ++ L +SI Sbjct: 224 FLPFVMTTAHALTKAMFCEVLLLFTLNTLEQSI 256 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,323,561 Number of Sequences: 59808 Number of extensions: 463988 Number of successful extensions: 1273 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1082 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1269 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2179815638 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -