BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120277.Seq (791 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 25 0.61 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 22 5.7 AF393496-1|AAL60421.1| 146|Apis mellifera odorant binding prote... 21 9.9 AF339140-1|AAK01304.1| 120|Apis mellifera odorant binding prote... 21 9.9 AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase pro... 21 9.9 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 25.4 bits (53), Expect = 0.61 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +2 Query: 581 HLRSVRFDFANALL-VCRPVAEHIYCKQLFVLLLPSSPITITLEITF 718 H RS R F + R VA H Y K+L + L+ + T+ +TF Sbjct: 132 HYRSKRRGFVYYTMGQIREVARHFYHKELQIELVREEILFDTVHVTF 178 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 22.2 bits (45), Expect = 5.7 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -3 Query: 513 MGGEQKLLKRLQRH 472 +GGE + L RL+RH Sbjct: 229 VGGESEALARLERH 242 >AF393496-1|AAL60421.1| 146|Apis mellifera odorant binding protein ASP6 protein. Length = 146 Score = 21.4 bits (43), Expect = 9.9 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = +3 Query: 183 MMLSNLQNNTIRTWDAVVKNGKKI 254 M+ + N + WD VKN + I Sbjct: 76 MIATKAMKNDVILWDFFVKNARMI 99 >AF339140-1|AAK01304.1| 120|Apis mellifera odorant binding protein protein. Length = 120 Score = 21.4 bits (43), Expect = 9.9 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = +3 Query: 183 MMLSNLQNNTIRTWDAVVKNGKKI 254 M+ + N + WD VKN + I Sbjct: 50 MIATKAMKNDVILWDFFVKNARMI 73 >AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase protein. Length = 588 Score = 21.4 bits (43), Expect = 9.9 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -1 Query: 263 RDWYFFAIFYNCVPRS 216 + W+ AIFY PRS Sbjct: 22 KGWWKNAIFYQVYPRS 37 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 213,414 Number of Sequences: 438 Number of extensions: 4309 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25003662 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -