BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120277.Seq (791 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containi... 34 0.094 At2g03190.1 68415.m00272 E3 ubiquitin ligase SCF complex subunit... 31 1.2 At4g33170.1 68417.m04725 pentatricopeptide (PPR) repeat-containi... 29 4.7 At3g03360.1 68416.m00334 F-box family protein low similarity to ... 28 6.2 At1g69545.1 68414.m07997 leucine-rich repeat family protein cont... 28 8.2 >At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identical over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat Length = 894 Score = 34.3 bits (75), Expect = 0.094 Identities = 20/62 (32%), Positives = 31/62 (50%), Gaps = 4/62 (6%) Frame = +3 Query: 447 GLHLSKFKNAFASVSTTFVHHPS----KHRKMINDAGGSCHNTVKYMVDIYGASVLILRT 614 G+H KF AF +S++ + K+ +M D CH+T KY+ YG +L+ T Sbjct: 822 GIHSEKFAMAFGLISSSGASKTTIRILKNLRMCRD----CHDTAKYVSKRYGCDILLEDT 877 Query: 615 PC 620 C Sbjct: 878 RC 879 >At2g03190.1 68415.m00272 E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 (At16), putative E3 ubiquitin ligase; similar to Skp1 homolog Skp1a GI:3068807 from [Arabidopsis thaliana] Length = 170 Score = 30.7 bits (66), Expect = 1.2 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = +3 Query: 96 SILVVMYESMEKHFSNVVDEIDSLKTDTFMMLSNLQNNTIRTWDA 230 +IL ++ E +KH + VD+ D T ++ N +RTWDA Sbjct: 50 NILALVIEYCKKHVLDDVDDSDDSTEATSENVNEEAKNELRTWDA 94 >At4g33170.1 68417.m04725 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 990 Score = 28.7 bits (61), Expect = 4.7 Identities = 16/53 (30%), Positives = 26/53 (49%), Gaps = 2/53 (3%) Frame = +3 Query: 453 HLSKFKNAFASVSTTFVHHPSKHRKMINDAG--GSCHNTVKYMVDIYGASVLI 605 H K AF +ST PS ++I + G CHN +KY+ +Y +++ Sbjct: 922 HSEKLAVAFGLLSTP----PSTPIRVIKNLRVCGDCHNAMKYIAKVYNREIVL 970 >At3g03360.1 68416.m00334 F-box family protein low similarity to ribosomal RNA apurinic site specific lyase [Triticum aestivum] GI:6505722; contains F-box domain Pfam:PF00646 Length = 481 Score = 28.3 bits (60), Expect = 6.2 Identities = 14/22 (63%), Positives = 16/22 (72%) Frame = +2 Query: 650 YCKQLFVLLLPSSPITITLEIT 715 +CK+L VL L SP ITLEIT Sbjct: 221 FCKKLKVLDLSKSPRLITLEIT 242 >At1g69545.1 68414.m07997 leucine-rich repeat family protein contains Pfam PF00560: Leucine Rich Repeat domains; similar to disease resistance protein RPP1-WsA (GI:3860163)[Arabidopsis thaliana] Length = 703 Score = 27.9 bits (59), Expect = 8.2 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = -2 Query: 190 NIINVSVLRESISSTTLEKCFSIDSYMTTSIDFISCSSLFKCPA 59 N+IN+ L S S+ +E SI + +D CSSL + P+ Sbjct: 377 NLINLKTLNLSGCSSLVELPSSIGNLNLKKLDLSGCSSLVELPS 420 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,084,504 Number of Sequences: 28952 Number of extensions: 316687 Number of successful extensions: 875 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 852 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 875 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1785055200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -