Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120274.Seq
         (693 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY703685-1|AAU12681.1|  200|Apis mellifera abdominal-A protein.        24   1.2  

>AY703685-1|AAU12681.1|  200|Apis mellifera abdominal-A protein.
          Length = 200

 Score = 24.2 bits (50), Expect = 1.2
 Identities = 13/66 (19%), Positives = 27/66 (40%)
 Frame = +3

Query: 15  NNQTTMTQINFNASYTSAPTPSRASFDNGYSEFCDKQQPNDYLNYYNNPTPDGADTVVSD 194
           ++Q   +  N         +P+ AS ++  S         +Y   +N+P+P G+    S 
Sbjct: 14  HHQQLFSSANPGTIQACTTSPATASLESSLSAAAVAAAAVNYAQQHNSPSPTGSSPQHSG 73

Query: 195 SETAAA 212
           S  + +
Sbjct: 74  SSASTS 79


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 183,958
Number of Sequences: 438
Number of extensions: 3810
Number of successful extensions: 7
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 21195810
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)