BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120273.Seq (777 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF395079-1|AAK97461.1| 371|Anopheles gambiae basic helix-loop-h... 28 0.28 AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering In... 26 1.1 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 25 2.6 AF510719-1|AAP47148.1| 591|Anopheles gambiae ammonium transport... 25 2.6 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 24 6.0 >AF395079-1|AAK97461.1| 371|Anopheles gambiae basic helix-loop-helix transcriptionfactor ASH protein. Length = 371 Score = 28.3 bits (60), Expect = 0.28 Identities = 14/48 (29%), Positives = 19/48 (39%) Frame = +1 Query: 556 RQHHPPRRHNGSPSGNRHQQFPSQASTLPISGKFQAHDINNQQSQLVP 699 +QHH H P QQ+ S P+ K + HD +L P Sbjct: 309 QQHH---HHQHQPQQQHQQQYHSHPHHTPVQFKTELHDNTQYDEELSP 353 Score = 27.5 bits (58), Expect = 0.49 Identities = 14/48 (29%), Positives = 19/48 (39%) Frame = +1 Query: 46 RQHHPPRRHGGSPSGNRHQQFPSQASTLPISGKFQAHDINNQQSQLVP 189 +QHH H P QQ+ S P+ K + HD +L P Sbjct: 309 QQHH---HHQHQPQQQHQQQYHSHPHHTPVQFKTELHDNTQYDEELSP 353 >AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering Institute proto-oncogeneproduct protein. Length = 358 Score = 26.2 bits (55), Expect = 1.1 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = +1 Query: 40 LSRQHHPPRRHGGSPSGNRHQQFPSQASTLP 132 L+ QHH H G PSG + S LP Sbjct: 58 LASQHHALSHHAGEPSGGGGGRAGSDEDELP 88 Score = 25.4 bits (53), Expect = 2.0 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = +1 Query: 550 LSRQHHPPRRHNGSPSGNRHQQFPSQASTLP 642 L+ QHH H G PSG + S LP Sbjct: 58 LASQHHALSHHAGEPSGGGGGRAGSDEDELP 88 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 25.0 bits (52), Expect = 2.6 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = +1 Query: 541 LAWLSRQHHPPRRHNGSPSGNRHQQFPSQASTL 639 LAW Q + P+ N + + HQQ +Q L Sbjct: 406 LAWFGEQRNRPKDRNQPATLHHHQQVHNQQRIL 438 >AF510719-1|AAP47148.1| 591|Anopheles gambiae ammonium transport-like protein protein. Length = 591 Score = 25.0 bits (52), Expect = 2.6 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = +1 Query: 619 PSQASTLPISGKFQAHDINNQQSQLVPG-FCVSMAFTNLVGT 741 P AST P G FQ+ NN S ++PG + +++ TN V T Sbjct: 10 PGAASTTPSPGAFQSLARNN--SYVIPGLYDLNVEDTNWVLT 49 Score = 24.2 bits (50), Expect = 4.6 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 109 PSQASTLPISGKFQAHDINNQQSQLVPG 192 P AST P G FQ+ NN S ++PG Sbjct: 10 PGAASTTPSPGAFQSLARNN--SYVIPG 35 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 23.8 bits (49), Expect = 6.0 Identities = 14/55 (25%), Positives = 26/55 (47%) Frame = +2 Query: 290 AISVTGFNFTHIR*IPSSCKILIPYSSSMAFTSLVDTLANTIHRDAITAPLVETA 454 ++ + F H++ S I+ YS L LAN +HR+A ++ ++ A Sbjct: 1073 SMPIQAFEMIHLKTYQGS--IIQKYSRLSCILELDTMLANHLHREAFSSSELQKA 1125 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 834,452 Number of Sequences: 2352 Number of extensions: 17457 Number of successful extensions: 39 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 39 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 81081585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -