BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120273.Seq (777 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 25 0.79 U15955-1|AAA67443.1| 95|Apis mellifera defensin precursor prot... 22 5.5 AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. 22 5.5 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 5.5 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 21 9.7 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 25.0 bits (52), Expect = 0.79 Identities = 21/65 (32%), Positives = 26/65 (40%), Gaps = 4/65 (6%) Frame = +1 Query: 76 GSPSGNRHQQFPSQASTLPISGKFQAHDINNQQSQLVP----GFCA*HGFHQFSRHSRQH 243 G P G Q PSQ P SG Q + QQ L P F H + + +QH Sbjct: 49 GGPPGAPPSQNPSQMMISPASGIHQMQQL-LQQHILSPTQLQSFMQQHSLY-LQQQQQQH 106 Query: 244 HPPSA 258 H S+ Sbjct: 107 HQDSS 111 Score = 22.6 bits (46), Expect = 4.2 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = +1 Query: 433 GSPSGNRHQQFPSQASTLPISGYKRQQK 516 G P G Q PSQ P SG + Q+ Sbjct: 49 GGPPGAPPSQNPSQMMISPASGIHQMQQ 76 Score = 22.2 bits (45), Expect = 5.5 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +1 Query: 586 GSPSGNRHQQFPSQASTLPISGKFQAHDINNQ 681 G P G Q PSQ P SG Q + Q Sbjct: 49 GGPPGAPPSQNPSQMMISPASGIHQMQQLLQQ 80 >U15955-1|AAA67443.1| 95|Apis mellifera defensin precursor protein. Length = 95 Score = 22.2 bits (45), Expect = 5.5 Identities = 7/24 (29%), Positives = 13/24 (54%) Frame = -3 Query: 706 RSQGQADFVGCLCHELGIYLIWVK 635 ++ G + VGC+C + +W K Sbjct: 69 KAGGHCEKVGCICRKTSFKDLWDK 92 Score = 22.2 bits (45), Expect = 5.5 Identities = 7/24 (29%), Positives = 13/24 (54%) Frame = -3 Query: 196 RSQGQADFVGCLCHELGIYLIWVK 125 ++ G + VGC+C + +W K Sbjct: 69 KAGGHCEKVGCICRKTSFKDLWDK 92 >AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. Length = 200 Score = 22.2 bits (45), Expect = 5.5 Identities = 11/24 (45%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Frame = +3 Query: 252 ERHNG-SPSGNRHQQFPSQASTLP 320 ++HN SP+G+ Q S AST P Sbjct: 57 QQHNSPSPTGSSPQHSGSSASTSP 80 Score = 21.8 bits (44), Expect = 7.3 Identities = 11/24 (45%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Frame = +1 Query: 574 RRHNG-SPSGNRHQQFPSQASTLP 642 ++HN SP+G+ Q S AST P Sbjct: 57 QQHNSPSPTGSSPQHSGSSASTSP 80 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.2 bits (45), Expect = 5.5 Identities = 15/64 (23%), Positives = 24/64 (37%), Gaps = 1/64 (1%) Frame = +1 Query: 550 LSRQHHPPRR-HNGSPSGNRHQQFPSQASTLPISGKFQAHDINNQQSQLVPGFCVSMAFT 726 L PP + S S +R + P P++ A + L+P +C+ Sbjct: 435 LPHDDQPPLSPQSDSSSSSRSAESPMSVQVDPMAASVVAAALTGTYPTLLPQWCLPPREA 494 Query: 727 NLVG 738 LVG Sbjct: 495 PLVG 498 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 21.4 bits (43), Expect = 9.7 Identities = 9/33 (27%), Positives = 17/33 (51%) Frame = +1 Query: 34 AWLSRQHHPPRRHGGSPSGNRHQQFPSQASTLP 132 ++ + + P R+GG ++HQQ A +P Sbjct: 3 SYFANSYIPDLRNGGVEHPHQHQQHYGAAVQVP 35 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 220,032 Number of Sequences: 438 Number of extensions: 4916 Number of successful extensions: 19 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24396777 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -