BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120268.Seq (833 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_02_0081 + 6432957-6433289,6433367-6433882,6434283-6434570 30 2.6 06_03_1510 + 30665857-30666038,30666137-30666236,30666358-306664... 29 6.0 >05_02_0081 + 6432957-6433289,6433367-6433882,6434283-6434570 Length = 378 Score = 29.9 bits (64), Expect = 2.6 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = -1 Query: 539 CQICPQEQQFFFAGSDCLLILASDILRGDVAIHTCLAFV 423 C IC + +FF D L+ S DVA+HT AFV Sbjct: 107 CDICQESHAYFFCLEDRALLCRS----CDVAVHTANAFV 141 >06_03_1510 + 30665857-30666038,30666137-30666236,30666358-30666438, 30666514-30666618,30666722-30666916,30667440-30667501, 30667870-30667885,30668007-30668068,30668933-30668951 Length = 273 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/40 (32%), Positives = 24/40 (60%) Frame = -1 Query: 446 IHTCLAFVFLCWSYLDSFVITTPIFKWLDILTTRWQRYNN 327 +H CLAF+F ++L +F + + IL +RW R+++ Sbjct: 12 LHCCLAFLFKFLAFLQAFAAVSALLYAAWIL-SRWARHHH 50 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,056,331 Number of Sequences: 37544 Number of extensions: 347913 Number of successful extensions: 751 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 727 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 750 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2303447664 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -