BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120268.Seq (833 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19774| Best HMM Match : WWE (HMM E-Value=5.4e-24) 29 3.5 SB_3877| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 >SB_19774| Best HMM Match : WWE (HMM E-Value=5.4e-24) Length = 729 Score = 29.5 bits (63), Expect = 3.5 Identities = 11/27 (40%), Positives = 19/27 (70%), Gaps = 1/27 (3%) Frame = -1 Query: 332 NNTTHLIFSCLFNFLDNSESLPF-HKC 255 N TH++F+CL+N +++S + HKC Sbjct: 192 NAFTHVLFACLYNIMNSSVGVAVRHKC 218 >SB_3877| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -1 Query: 344 WQRYNNTTHLIFSCLFNFLDNSESLPFHKCG 252 WQ N +LI + + L N LP+HKCG Sbjct: 2 WQVITNVAYLITNVAY--LINECGLPYHKCG 30 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,172,520 Number of Sequences: 59808 Number of extensions: 439164 Number of successful extensions: 885 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 818 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 884 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2347493764 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -