BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120268.Seq (833 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF016419-9|AAG24054.1| 2025|Caenorhabditis elegans Hypothetical ... 29 5.4 AL034488-2|CAA22448.1| 210|Caenorhabditis elegans Hypothetical ... 28 9.5 >AF016419-9|AAG24054.1| 2025|Caenorhabditis elegans Hypothetical protein F07G11.9 protein. Length = 2025 Score = 28.7 bits (61), Expect = 5.4 Identities = 11/41 (26%), Positives = 21/41 (51%) Frame = +1 Query: 394 KLSK*LQHRNTKARQVCIATSPLNISEASISKQSEPAKKNC 516 ++S+ + N KA+ +C+ T P + S++ P NC Sbjct: 916 QVSQKILKANCKAKPICLGTGPFKQEQCISSRRVTPENDNC 956 >AL034488-2|CAA22448.1| 210|Caenorhabditis elegans Hypothetical protein Y54G11A.2 protein. Length = 210 Score = 27.9 bits (59), Expect = 9.5 Identities = 13/26 (50%), Positives = 17/26 (65%), Gaps = 2/26 (7%) Frame = -3 Query: 207 IEFGW*T-VWFHSNSFNGAH-YLVLH 136 I++GW VWFH + + AH YL LH Sbjct: 29 IKYGWPEDVWFHVDKLSSAHVYLRLH 54 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,958,747 Number of Sequences: 27780 Number of extensions: 360219 Number of successful extensions: 783 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 762 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 783 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 2072006206 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -