BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120267.Seq (729 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. 25 0.63 AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. 25 0.63 AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 23 1.9 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 22 4.4 U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. 22 5.8 >X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. Length = 251 Score = 25.0 bits (52), Expect = 0.63 Identities = 14/41 (34%), Positives = 20/41 (48%), Gaps = 4/41 (9%) Frame = +1 Query: 442 TCRRHYHLHCLRPPLTRPPKKSNCTDGN----VRSVIKHPT 552 T +Y + PP+T PP NC N + SV++ PT Sbjct: 31 TTYEYYENNQALPPITYPPSDWNCPQYNAPPYMSSVLQLPT 71 >AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. Length = 246 Score = 25.0 bits (52), Expect = 0.63 Identities = 14/41 (34%), Positives = 20/41 (48%), Gaps = 4/41 (9%) Frame = +1 Query: 442 TCRRHYHLHCLRPPLTRPPKKSNCTDGN----VRSVIKHPT 552 T +Y + PP+T PP NC N + SV++ PT Sbjct: 22 TTYEYYENNQALPPITYPPSDWNCPQYNAPPYMSSVLQLPT 62 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/26 (38%), Positives = 10/26 (38%) Frame = -2 Query: 422 GRSLRPPHTAHAPHNDAEQHKKKHNH 345 G L PH AH P H NH Sbjct: 22 GAGLYEPHVAHRPGLQGLHHSPHLNH 47 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 22.2 bits (45), Expect = 4.4 Identities = 7/18 (38%), Positives = 11/18 (61%) Frame = +3 Query: 513 YGWQCSECDKTSDSEPEC 566 + W C++ TSDS +C Sbjct: 1039 FSWACNDAVMTSDSIMKC 1056 >U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. Length = 470 Score = 21.8 bits (44), Expect = 5.8 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -2 Query: 413 LRPPHTAHAPHNDAEQHKKKHNHL 342 +RPP T H A ++ K H +L Sbjct: 365 VRPPLTREEIHEKARENLKHHANL 388 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 144,968 Number of Sequences: 336 Number of extensions: 2638 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19467635 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -