BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120264X.Seq (533 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC12G12.16c ||SPAC18B11.01c|nuclease, XP-G family|Schizosaccha... 26 3.1 SPAC1782.04 |cox24||mitochondrial mRNA processing protein Cox24 ... 25 5.4 SPBC12D12.03 |cct1||chaperonin-containing T-complex alpha subuni... 25 7.1 SPAC6G9.12 |cfr1||Chs five related protein Cfr1|Schizosaccharomy... 25 9.4 >SPAC12G12.16c ||SPAC18B11.01c|nuclease, XP-G family|Schizosaccharomyces pombe|chr 1|||Manual Length = 496 Score = 26.2 bits (55), Expect = 3.1 Identities = 18/63 (28%), Positives = 31/63 (49%), Gaps = 1/63 (1%) Frame = +1 Query: 235 RRRLQKRLKCIDFDYYGLCSKKMFCNLQTN-LQKCVDQHYAELDVLTRQIYMSNPLVMLK 411 R L+ L +D + LC K + L + LQK + ELD L R++Y +P + + Sbjct: 221 RSYLEFILSNLDLECLTLCLKIIKGILTLDELQKAIKLKQTELDKLERRLYRPSPQNIFE 280 Query: 412 CYQ 420 ++ Sbjct: 281 IFE 283 >SPAC1782.04 |cox24||mitochondrial mRNA processing protein Cox24 |Schizosaccharomyces pombe|chr 1|||Manual Length = 175 Score = 25.4 bits (53), Expect = 5.4 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 3/35 (8%) Frame = -3 Query: 231 IWHVTAAPPVNT--NKPPFSQTT-ASKQSLINANF 136 IWHV+A+P V + N P T+ S + + ANF Sbjct: 25 IWHVSASPEVGSKYNLPTVPTTSHVSYRQIAKANF 59 >SPBC12D12.03 |cct1||chaperonin-containing T-complex alpha subunit Cct1|Schizosaccharomyces pombe|chr 2|||Manual Length = 556 Score = 25.0 bits (52), Expect = 7.1 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +2 Query: 8 RVASSSPLFIMERLLNQLNLGVLPYITTKDIEDRLRDKIVAKAKLAFIKDC 160 ++ + +ER+ LN G +TTK I+D I+ +A ++ C Sbjct: 267 KIREREVMITLERVKKILNAGANVILTTKGIDDLCLKSIIEAGAMA-VRRC 316 >SPAC6G9.12 |cfr1||Chs five related protein Cfr1|Schizosaccharomyces pombe|chr 1|||Manual Length = 620 Score = 24.6 bits (51), Expect = 9.4 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +1 Query: 250 KRLKCIDFDYYGLCSKKMFCNLQTNLQKCVDQHYA 354 K L+ ID +C M N LQKC+++ +A Sbjct: 165 KTLRMIDLTGIQVCVGNMVPNEMEALQKCIERIHA 199 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,025,982 Number of Sequences: 5004 Number of extensions: 37112 Number of successful extensions: 108 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 107 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 108 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 220420454 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -