BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120264X.Seq (533 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0068 + 5390004-5390425,5390517-5390949 28 4.1 07_01_0889 + 7426680-7427396,7428073-7428222,7429296-7429601 28 5.4 >03_02_0068 + 5390004-5390425,5390517-5390949 Length = 284 Score = 28.3 bits (60), Expect = 4.1 Identities = 18/57 (31%), Positives = 28/57 (49%) Frame = -2 Query: 502 HRCTVFLCILYGGLSANRFDRLVYRLRFDNISALPTDLTCKFDALTRPIQRNVGRRI 332 HR ++ + G ++ + FD +R R+DN+ A DL DAL P VG + Sbjct: 62 HRVVLYDLVCAGSVNPDHFD---FR-RYDNLDAYVDDLLAILDALRIPRCAFVGHSV 114 >07_01_0889 + 7426680-7427396,7428073-7428222,7429296-7429601 Length = 390 Score = 27.9 bits (59), Expect = 5.4 Identities = 14/44 (31%), Positives = 25/44 (56%), Gaps = 2/44 (4%) Frame = +2 Query: 17 SSSPLFIMERLLNQLNLGVLPYITTKDI--EDRLRDKIVAKAKL 142 SS ++E +LN + G+L Y+ D+ ED + ++ +K KL Sbjct: 325 SSPTALVVEGILNSVAAGILIYMALVDLLAEDFMNPRVQSKGKL 368 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,637,172 Number of Sequences: 37544 Number of extensions: 227914 Number of successful extensions: 586 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 573 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 586 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1190246000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -