BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120264X.Seq (533 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g67310.1 68418.m08488 cytochrome P450 family protein 27 5.9 At4g38890.1 68417.m05508 dihydrouridine synthase family protein ... 27 5.9 >At5g67310.1 68418.m08488 cytochrome P450 family protein Length = 507 Score = 27.5 bits (58), Expect = 5.9 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +1 Query: 256 LKCIDFDYYGLCSKKMFCNLQTNLQKCVDQH 348 LK D D Y +KK+ L +QK VD+H Sbjct: 238 LKLFDLDGYRKRAKKLASKLDKFMQKLVDEH 268 >At4g38890.1 68417.m05508 dihydrouridine synthase family protein contains Pfam domain, PF01207: Dihydrouridine synthase (Dus) Length = 700 Score = 27.5 bits (58), Expect = 5.9 Identities = 14/39 (35%), Positives = 18/39 (46%) Frame = +1 Query: 202 NWRRGCDMPYRRRRLQKRLKCIDFDYYGLCSKKMFCNLQ 318 NW + R R Q+ K D+DY C+K NLQ Sbjct: 498 NWGATAVTIHGRSRQQRYSKSADWDYIYQCTKNATTNLQ 536 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,420,668 Number of Sequences: 28952 Number of extensions: 189707 Number of successful extensions: 457 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 444 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 457 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 984125600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -