BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120261.Seq (768 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value M29488-1|AAA27723.1| 86|Apis mellifera protein ( Bee homeobox-... 23 2.4 M29493-1|AAA27728.1| 74|Apis mellifera protein ( Bee homeobox-... 22 5.5 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 22 5.5 M29494-1|AAA27729.1| 74|Apis mellifera protein ( Bee homeobox-... 22 7.2 DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 22 7.2 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 22 7.2 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 22 7.2 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 22 7.2 AJ555537-1|CAD88245.1| 210|Apis mellifera putative chemosensory... 21 9.5 >M29488-1|AAA27723.1| 86|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone H55. ). Length = 86 Score = 23.4 bits (48), Expect = 2.4 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -2 Query: 281 KSMHFNALLSRRRR 240 K HFN L+RRRR Sbjct: 25 KEFHFNRYLTRRRR 38 >M29493-1|AAA27728.1| 74|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone H90. ). Length = 74 Score = 22.2 bits (45), Expect = 5.5 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -2 Query: 281 KSMHFNALLSRRRR 240 K H+N L+RRRR Sbjct: 25 KEFHYNRYLTRRRR 38 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 22.2 bits (45), Expect = 5.5 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -2 Query: 281 KSMHFNALLSRRRR 240 K H+N L+RRRR Sbjct: 287 KEFHYNRYLTRRRR 300 >M29494-1|AAA27729.1| 74|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone H15. ). Length = 74 Score = 21.8 bits (44), Expect = 7.2 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -2 Query: 281 KSMHFNALLSRRRR 240 K H+N L+RRRR Sbjct: 25 KEFHYNHYLTRRRR 38 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 21.8 bits (44), Expect = 7.2 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +2 Query: 233 CHIDDDDSKAH*NA*ILIITAFAQKKCFATC 325 C I ++ NA +L ITAF ++ A C Sbjct: 127 CIIQSFAAETSANATVLTITAFTVERYIAIC 157 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 7.2 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +2 Query: 164 DCFEAVVCENGGLFVLTGGAAV 229 DC +A+ N L V++GG+ + Sbjct: 425 DCLKAIKENNADLTVVSGGSVL 446 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 7.2 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +2 Query: 164 DCFEAVVCENGGLFVLTGGAAV 229 DC +A+ N L V++GG+ + Sbjct: 425 DCLKAIKENNADLTVVSGGSVL 446 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 7.2 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +2 Query: 164 DCFEAVVCENGGLFVLTGGAAV 229 DC +A+ N L V++GG+ + Sbjct: 425 DCLKAIKENNADLTVVSGGSVL 446 >AJ555537-1|CAD88245.1| 210|Apis mellifera putative chemosensory receptor 2 protein. Length = 210 Score = 21.4 bits (43), Expect = 9.5 Identities = 14/55 (25%), Positives = 30/55 (54%) Frame = +3 Query: 90 ILRQRILKIACAIKLWLKQSWHLSKIVSKP*FAKTEVYSC*LEARL*HAISTTTT 254 + +++ + + AIK W+++ H+ ++V+ A + Y A L H ++TT T Sbjct: 91 LTKKQEMLVRSAIKYWVERHKHIVRLVT----AIGDAYGV---ALLLHMLTTTIT 138 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 199,471 Number of Sequences: 438 Number of extensions: 3525 Number of successful extensions: 14 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24032646 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -