BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120260.Seq (395 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory recept... 28 0.039 AM712904-1|CAN84643.1| 86|Tribolium castaneum hypothetical pro... 22 1.9 >AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory receptor candidate 42 protein. Length = 347 Score = 27.9 bits (59), Expect = 0.039 Identities = 13/32 (40%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = -3 Query: 294 INKILHEFDDIYSIGKFQ-SKNALLQILGRIT 202 IN +L+ + D + G F +K LLQI+G +T Sbjct: 303 INVVLNNYPDFSAAGFFSINKTTLLQIIGNVT 334 >AM712904-1|CAN84643.1| 86|Tribolium castaneum hypothetical protein protein. Length = 86 Score = 22.2 bits (45), Expect = 1.9 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -3 Query: 60 YITRIHPLRNANKNLI 13 Y+ HPL +NKN I Sbjct: 45 YVKHFHPLALSNKNAI 60 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 87,948 Number of Sequences: 336 Number of extensions: 1709 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 8435920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -