BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120259.Seq (737 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcript... 29 0.11 AY705402-1|AAU12511.1| 509|Anopheles gambiae nicotinic acetylch... 25 1.8 AY705399-1|AAU12508.1| 533|Anopheles gambiae nicotinic acetylch... 25 1.8 AY705401-1|AAU12510.1| 490|Anopheles gambiae nicotinic acetylch... 25 3.2 AY705400-1|AAU12509.1| 490|Anopheles gambiae nicotinic acetylch... 25 3.2 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 24 4.3 AY748839-1|AAV28187.1| 169|Anopheles gambiae cytochrome P450 pr... 24 4.3 AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcript... 24 4.3 AJ304410-1|CAC67443.1| 190|Anopheles gambiae calpain protein. 23 7.4 M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 23 9.8 >AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcriptase protein. Length = 1209 Score = 29.5 bits (63), Expect = 0.11 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -1 Query: 416 TRFRDGSQIVHQIGLGHTNTGIDDRKSALVLVG 318 T+ R+GS I HQ N + DR+ +L+L G Sbjct: 55 TQNRNGSPINHQGNAASANVAVADRQQSLILAG 87 >AY705402-1|AAU12511.1| 509|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 7 protein. Length = 509 Score = 25.4 bits (53), Expect = 1.8 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +2 Query: 581 FTVRPDSGEPLGRGTKIVL 637 FT+ PDSGE L G I+L Sbjct: 236 FTLPPDSGEKLSLGVTILL 254 >AY705399-1|AAU12508.1| 533|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 5 protein. Length = 533 Score = 25.4 bits (53), Expect = 1.8 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +2 Query: 581 FTVRPDSGEPLGRGTKIVL 637 FT+ PDSGE L G I+L Sbjct: 268 FTLPPDSGEKLSLGVTILL 286 >AY705401-1|AAU12510.1| 490|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 6 protein. Length = 490 Score = 24.6 bits (51), Expect = 3.2 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +2 Query: 581 FTVRPDSGEPLGRGTKIVLHVKEDLAEFMEEHKITE 688 FT+ PDSGE L G I+ V + + + H IT+ Sbjct: 253 FTLPPDSGEKLTLGLTIL--VSQTVFSLLVGHVITK 286 >AY705400-1|AAU12509.1| 490|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 6 protein. Length = 490 Score = 24.6 bits (51), Expect = 3.2 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +2 Query: 581 FTVRPDSGEPLGRGTKIVL 637 FT+ PDSGE L G I+L Sbjct: 253 FTLPPDSGEKLTLGVTILL 271 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 24.2 bits (50), Expect = 4.3 Identities = 20/73 (27%), Positives = 30/73 (41%), Gaps = 6/73 (8%) Frame = +2 Query: 476 RCWLLLQLLGRDRVTVHSKHN------DDEQYVWESSAGGSFTVRPDSGEPLGRGTKIVL 637 R L+ + +G VH ++N DD Y W G VR G L R K L Sbjct: 44 RALLIYERMGGSWSEVHKRNNFFAVSNDDASYPWAVYDDGLLAVRKVKGFVLYRWNKKEL 103 Query: 638 HVKEDLAEFMEEH 676 + A++ +E+ Sbjct: 104 NELLVAAKYHDEY 116 >AY748839-1|AAV28187.1| 169|Anopheles gambiae cytochrome P450 protein. Length = 169 Score = 24.2 bits (50), Expect = 4.3 Identities = 21/81 (25%), Positives = 30/81 (37%) Frame = -1 Query: 554 RIARRHCV*SEQSRGRDQVTGVEANTELSNHADVGTCLKSLHESFSTRFRDGSQIVHQIG 375 R+ V R D+V G L + + +L E+ S I H++ Sbjct: 18 RLLHNPPVIERMQREIDEVVGHGRLPTLDDRTQLAYTEATLREAMRIDTLVPSGIAHRVQ 77 Query: 374 LGHTNTGIDDRKSALVLVGND 312 T G D K LVL+G D Sbjct: 78 EDTTLRGYDLPKDTLVLIGLD 98 >AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcriptase protein. Length = 1049 Score = 24.2 bits (50), Expect = 4.3 Identities = 13/47 (27%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = +3 Query: 555 CGNLLQEARSQSAQTAVSPLVEVQR--SSFTSKRTWQNSWKNTKSQR 689 C L +++++ A E + S S R WQN W N+ + R Sbjct: 876 CITLEEDSKNFRKSRAGESFTETAKKASRQASMRQWQNEWSNSLNGR 922 >AJ304410-1|CAC67443.1| 190|Anopheles gambiae calpain protein. Length = 190 Score = 23.4 bits (48), Expect = 7.4 Identities = 9/28 (32%), Positives = 13/28 (46%) Frame = +2 Query: 311 DHSQQERGHSYDHRYRYWYDQGRFGEQF 394 D +QE G ++DH +W F F Sbjct: 34 DEQKQELGLNFDHDGEFWMSYRDFTRYF 61 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 23.0 bits (47), Expect = 9.8 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = -3 Query: 111 CLHFFRHFLYCFLFNS 64 C F HF Y F F+S Sbjct: 945 CFRLFNHFYYLFDFDS 960 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 797,899 Number of Sequences: 2352 Number of extensions: 18683 Number of successful extensions: 47 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 44 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 47 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 75676146 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -