BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120257.Seq (828 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL834382-1|CAD39045.1| 505|Homo sapiens hypothetical protein pr... 31 6.7 U06711-1|AAA18431.1| 1056|Homo sapiens tracheobronchial mucin pr... 30 8.9 BC150266-1|AAI50267.1| 1336|Homo sapiens mitogen-activated prote... 30 8.9 AL031717-1|CAM26394.1| 1336|Homo sapiens mitogen-activated prote... 30 8.9 AL031710-1|CAM26364.1| 1336|Homo sapiens mitogen-activated prote... 30 8.9 AE006639-4|AAK61290.1| 1342|Homo sapiens similar to sperm specif... 30 8.9 AB028989-1|BAA83018.2| 1346|Homo sapiens KIAA1066 protein protein. 30 8.9 >AL834382-1|CAD39045.1| 505|Homo sapiens hypothetical protein protein. Length = 505 Score = 30.7 bits (66), Expect = 6.7 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = +1 Query: 184 RRLSMPTKSSTMLQIAWQSRATR*FAPTHSA 276 R L++P +S ML++ W+ + R F PT SA Sbjct: 325 RELALPGCTSRMLKLTWRCASCRTFTPTFSA 355 >U06711-1|AAA18431.1| 1056|Homo sapiens tracheobronchial mucin protein. Length = 1056 Score = 30.3 bits (65), Expect = 8.9 Identities = 18/45 (40%), Positives = 22/45 (48%) Frame = +2 Query: 200 RPNPAPCSR*RGKAGRPADLHPHTVLITKSGVIQLIMKSKLPYAI 334 R NP+P R R AGR A PH + T + L K LPY + Sbjct: 1015 RRNPSPARRQRVGAGREASSVPHALTSTAA---LLTSKENLPYVL 1056 >BC150266-1|AAI50267.1| 1336|Homo sapiens mitogen-activated protein kinase 8 interacting protein 3 protein. Length = 1336 Score = 30.3 bits (65), Expect = 8.9 Identities = 16/51 (31%), Positives = 29/51 (56%) Frame = +2 Query: 401 AVEMDTNDVIAKIDDLTQKLTVANADLAEANRSLILLPTK*LWLDATLKRL 553 A+ + ND+IAK+D L+ + V +L A ++ + L + L+ LKR+ Sbjct: 436 ALNVVKNDLIAKVDQLSGEQEVLRGELEAAKQAKVKLENRIKELEEELKRV 486 >AL031717-1|CAM26394.1| 1336|Homo sapiens mitogen-activated protein kinase 8 interacting protein 3 protein. Length = 1336 Score = 30.3 bits (65), Expect = 8.9 Identities = 16/51 (31%), Positives = 29/51 (56%) Frame = +2 Query: 401 AVEMDTNDVIAKIDDLTQKLTVANADLAEANRSLILLPTK*LWLDATLKRL 553 A+ + ND+IAK+D L+ + V +L A ++ + L + L+ LKR+ Sbjct: 436 ALNVVKNDLIAKVDQLSGEQEVLRGELEAAKQAKVKLENRIKELEEELKRV 486 >AL031710-1|CAM26364.1| 1336|Homo sapiens mitogen-activated protein kinase 8 interacting protein 3 protein. Length = 1336 Score = 30.3 bits (65), Expect = 8.9 Identities = 16/51 (31%), Positives = 29/51 (56%) Frame = +2 Query: 401 AVEMDTNDVIAKIDDLTQKLTVANADLAEANRSLILLPTK*LWLDATLKRL 553 A+ + ND+IAK+D L+ + V +L A ++ + L + L+ LKR+ Sbjct: 436 ALNVVKNDLIAKVDQLSGEQEVLRGELEAAKQAKVKLENRIKELEEELKRV 486 >AE006639-4|AAK61290.1| 1342|Homo sapiens similar to sperm specifc protein protein. Length = 1342 Score = 30.3 bits (65), Expect = 8.9 Identities = 16/51 (31%), Positives = 29/51 (56%) Frame = +2 Query: 401 AVEMDTNDVIAKIDDLTQKLTVANADLAEANRSLILLPTK*LWLDATLKRL 553 A+ + ND+IAK+D L+ + V +L A ++ + L + L+ LKR+ Sbjct: 436 ALNVVKNDLIAKVDQLSGEQEVLRGELEAAKQAKVKLENRIKELEEELKRV 486 >AB028989-1|BAA83018.2| 1346|Homo sapiens KIAA1066 protein protein. Length = 1346 Score = 30.3 bits (65), Expect = 8.9 Identities = 16/51 (31%), Positives = 29/51 (56%) Frame = +2 Query: 401 AVEMDTNDVIAKIDDLTQKLTVANADLAEANRSLILLPTK*LWLDATLKRL 553 A+ + ND+IAK+D L+ + V +L A ++ + L + L+ LKR+ Sbjct: 446 ALNVVKNDLIAKVDQLSGEQEVLRGELEAAKQAKVKLENRIKELEEELKRV 496 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 124,389,062 Number of Sequences: 237096 Number of extensions: 2792483 Number of successful extensions: 6857 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 6443 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6857 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 10370898348 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -