BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120255.Seq (864 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 25 0.68 AF205594-1|AAQ13840.1| 156|Apis mellifera acid phosphatase prec... 22 8.4 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 25.4 bits (53), Expect = 0.68 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +3 Query: 567 HLRSVRFDFANALL-VCRPVAEHIYCKQLFVLLLPSSPITITLEITF 704 H RS R F + R VA H Y K+L + L+ + T+ +TF Sbjct: 132 HYRSKRRGFVYYTMGQIREVARHFYHKELQIELVREEILFDTVHVTF 178 >AF205594-1|AAQ13840.1| 156|Apis mellifera acid phosphatase precursor protein. Length = 156 Score = 21.8 bits (44), Expect = 8.4 Identities = 7/25 (28%), Positives = 15/25 (60%) Frame = -3 Query: 256 FVEIGYFFAIFYNCVPRSNRVILQV 182 F+ I YF +++N + R R +++ Sbjct: 16 FILINYFIFLYFNSLVRFRRFTIEL 40 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 223,754 Number of Sequences: 438 Number of extensions: 4427 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27916710 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -