BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120255.Seq (864 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containi... 31 0.75 At2g03190.1 68415.m00272 E3 ubiquitin ligase SCF complex subunit... 31 1.3 At1g67120.1 68414.m07636 midasin-related similar to Midasin (MID... 30 2.3 At3g03360.1 68416.m00334 F-box family protein low similarity to ... 29 4.0 At5g63020.1 68418.m07906 disease resistance protein (CC-NBS-LRR ... 29 5.3 At4g33170.1 68417.m04725 pentatricopeptide (PPR) repeat-containi... 28 9.2 At3g49170.1 68416.m05374 pentatricopeptide (PPR) repeat-containi... 28 9.2 At1g69545.1 68414.m07997 leucine-rich repeat family protein cont... 28 9.2 >At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identical over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat Length = 894 Score = 31.5 bits (68), Expect = 0.75 Identities = 18/60 (30%), Positives = 30/60 (50%), Gaps = 2/60 (3%) Frame = +1 Query: 433 GLHLSKFKNAFASVSTTFVHHPI*T*KMINDAG--GSCHNTVKYMVDIYGASVLILRTPC 606 G+H KF AF +S++ T +++ + CH+T KY+ YG +L+ T C Sbjct: 822 GIHSEKFAMAFGLISSSGASKT--TIRILKNLRMCRDCHDTAKYVSKRYGCDILLEDTRC 879 >At2g03190.1 68415.m00272 E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 (At16), putative E3 ubiquitin ligase; similar to Skp1 homolog Skp1a GI:3068807 from [Arabidopsis thaliana] Length = 170 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = +2 Query: 83 SILVVMYESMEKHFSNVVDEIDSLKTDTFMMLSNLQNNTIRTWDA 217 +IL ++ E +KH + VD+ D T ++ N +RTWDA Sbjct: 50 NILALVIEYCKKHVLDDVDDSDDSTEATSENVNEEAKNELRTWDA 94 >At1g67120.1 68414.m07636 midasin-related similar to Midasin (MIDAS-containing protein) (Swiss-Prot:Q12019) [Saccharomyces cerevisiae]; similar to Midasin (MIDAS-containing protein) (Swiss-Prot:Q9NU22) [Homo sapiens]; contains Prosite PS00017: ATP/GTP-binding site motif A (P-loop) Length = 5336 Score = 29.9 bits (64), Expect = 2.3 Identities = 17/50 (34%), Positives = 24/50 (48%) Frame = +2 Query: 104 ESMEKHFSNVVDEIDSLKTDTFMMLSNLQNNTIRTWDAVVKNGKKISNLD 253 E++ F+NV D I L + LS + I TWD + K + NLD Sbjct: 4343 ENLASIFANVKDVIGKLCSYKDGSLSQEEEMNITTWDGLFKKAENDLNLD 4392 >At3g03360.1 68416.m00334 F-box family protein low similarity to ribosomal RNA apurinic site specific lyase [Triticum aestivum] GI:6505722; contains F-box domain Pfam:PF00646 Length = 481 Score = 29.1 bits (62), Expect = 4.0 Identities = 16/35 (45%), Positives = 19/35 (54%) Frame = +3 Query: 636 YCKQLFVLLLPSSPITITLEITFSSRQTSFAISVP 740 +CK+L VL L SP ITLEIT R + P Sbjct: 221 FCKKLKVLDLSKSPRLITLEITRRCRMEPTQLVAP 255 >At5g63020.1 68418.m07906 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 888 Score = 28.7 bits (61), Expect = 5.3 Identities = 18/74 (24%), Positives = 38/74 (51%) Frame = +2 Query: 44 YAGHLNNELQEIKSILVVMYESMEKHFSNVVDEIDSLKTDTFMMLSNLQNNTIRTWDAVV 223 + GH+++ + +LVV+ SM + ++ +EI + ++ LS + IR W A + Sbjct: 544 FLGHISSSFFRLMPMLVVLDLSMNRDLRHLPNEISECVSLQYLSLSRTR---IRIWPAGL 600 Query: 224 KNGKKISNLDEKLT 265 +K+ L+ + T Sbjct: 601 VELRKLLYLNLEYT 614 >At4g33170.1 68417.m04725 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 990 Score = 27.9 bits (59), Expect = 9.2 Identities = 16/51 (31%), Positives = 24/51 (47%) Frame = +1 Query: 439 HLSKFKNAFASVSTTFVHHPI*T*KMINDAGGSCHNTVKYMVDIYGASVLI 591 H K AF +ST PI K + G CHN +KY+ +Y +++ Sbjct: 922 HSEKLAVAFGLLSTP-PSTPIRVIKNLRVCG-DCHNAMKYIAKVYNREIVL 970 >At3g49170.1 68416.m05374 pentatricopeptide (PPR) repeat-containing protein contains INTERPRO:IPR002885 PPR repeats Length = 850 Score = 27.9 bits (59), Expect = 9.2 Identities = 15/51 (29%), Positives = 25/51 (49%) Frame = +1 Query: 439 HLSKFKNAFASVSTTFVHHPI*T*KMINDAGGSCHNTVKYMVDIYGASVLI 591 H K AF +ST+ P+ K + G CHN +KY+ + G +++ Sbjct: 782 HSEKIAVAFGLISTS-KSRPVRVFKNLRVCG-DCHNAMKYISTVSGREIVL 830 >At1g69545.1 68414.m07997 leucine-rich repeat family protein contains Pfam PF00560: Leucine Rich Repeat domains; similar to disease resistance protein RPP1-WsA (GI:3860163)[Arabidopsis thaliana] Length = 703 Score = 27.9 bits (59), Expect = 9.2 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = -1 Query: 177 NIINVSVLRESISSTTLEKCFSIDSYMTTSIDFISCSSLFKCPA 46 N+IN+ L S S+ +E SI + +D CSSL + P+ Sbjct: 377 NLINLKTLNLSGCSSLVELPSSIGNLNLKKLDLSGCSSLVELPS 420 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,360,545 Number of Sequences: 28952 Number of extensions: 337765 Number of successful extensions: 991 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 967 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 991 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 2019160800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -