BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120253.Seq (622 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK055233-1|BAB70882.1| 473|Homo sapiens protein ( Homo sapiens ... 33 0.81 U89336-3|AAB47491.1| 404|Homo sapiens receptor for advanced gly... 31 4.3 M91211-1|AAA03574.1| 404|Homo sapiens receptor for advanced gly... 31 4.3 D28769-2|BAA05958.1| 404|Homo sapiens receptor of advanced glyc... 31 4.3 DQ104254-1|AAZ32415.1| 303|Homo sapiens receptor for advanced g... 31 4.3 DQ104252-1|AAZ32413.1| 390|Homo sapiens receptor for advanced g... 31 4.3 BX284686-16|CAM26224.1| 404|Homo sapiens advanced glycosylation... 31 4.3 BC020669-1|AAH20669.1| 404|Homo sapiens advanced glycosylation ... 31 4.3 AY755624-1|AAX07277.1| 390|Homo sapiens receptor for advanced g... 31 4.3 AY755621-1|AAX07274.1| 420|Homo sapiens receptor for advanced g... 31 4.3 AY755619-1|AAX07272.1| 404|Homo sapiens receptor for advanced g... 31 4.3 AL845464-16|CAI41810.1| 404|Homo sapiens advanced glycosylation... 31 4.3 AL662884-21|CAI18354.1| 404|Homo sapiens advanced glycosylation... 31 4.3 AL662830-3|CAI17536.1| 404|Homo sapiens advanced glycosylation ... 31 4.3 AB061669-1|BAC65466.1| 303|Homo sapiens N-terminal truncated fo... 31 4.3 AB036432-1|BAA89369.1| 404|Homo sapiens advanced glycation endp... 31 4.3 BX284686-17|CAM26225.1| 347|Homo sapiens advanced glycosylation... 30 7.6 AY755628-1|AAX07281.1| 347|Homo sapiens receptor for advanced g... 30 7.6 AY755622-1|AAX07275.1| 363|Homo sapiens receptor for advanced g... 30 7.6 AY755620-1|AAX07273.1| 347|Homo sapiens receptor for advanced g... 30 7.6 AL845464-17|CAM25716.1| 347|Homo sapiens advanced glycosylation... 30 7.6 AL662884-22|CAM25647.1| 347|Homo sapiens advanced glycosylation... 30 7.6 AL662830-4|CAM24893.1| 347|Homo sapiens advanced glycosylation ... 30 7.6 AF536237-1|AAQ10686.1| 147|Homo sapiens advanced glycosylation ... 30 7.6 AB061668-1|BAC65465.1| 347|Homo sapiens soluble form of recepto... 30 7.6 >AK055233-1|BAB70882.1| 473|Homo sapiens protein ( Homo sapiens cDNA FLJ30671 fis, clone FCBBF1000687, moderately similar to Mus musculus Rap2 interacting protein 8 (RPIP8) mRNA. ). Length = 473 Score = 33.1 bits (72), Expect = 0.81 Identities = 22/69 (31%), Positives = 31/69 (44%), Gaps = 1/69 (1%) Frame = +2 Query: 173 CAF*TSVPTDRCCSATPDTIGPMAQSLFSCVQQIYSH-AQHNSQTDRQLASIKKPGSRQT 349 C F DR C T D P + + ++QI SH + SQ+ R LA ++ P Q Sbjct: 40 CRFSVKTLIDRSCFETIDDSSPEFNNFAAILEQILSHRLKEISQSCRWLAHLQIPLQGQV 99 Query: 350 AARSLDSPR 376 +SPR Sbjct: 100 TWFGYESPR 108 >U89336-3|AAB47491.1| 404|Homo sapiens receptor for advanced glycosylation end products protein. Length = 404 Score = 30.7 bits (66), Expect = 4.3 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +2 Query: 230 IGPMAQSLFSCVQQIYSHAQHNSQTDRQLA-SIKKPGSRQTAARSLDSPRLDGYVLA 397 IGP Q +SCV +H+ H Q R ++ SI +PG A S+ L LA Sbjct: 291 IGPQDQGTYSCVA---THSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALA 344 >M91211-1|AAA03574.1| 404|Homo sapiens receptor for advanced glycosylation end products protein. Length = 404 Score = 30.7 bits (66), Expect = 4.3 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +2 Query: 230 IGPMAQSLFSCVQQIYSHAQHNSQTDRQLA-SIKKPGSRQTAARSLDSPRLDGYVLA 397 IGP Q +SCV +H+ H Q R ++ SI +PG A S+ L LA Sbjct: 291 IGPQDQGTYSCVA---THSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALA 344 >D28769-2|BAA05958.1| 404|Homo sapiens receptor of advanced glycosylation end products of proteins protein. Length = 404 Score = 30.7 bits (66), Expect = 4.3 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +2 Query: 230 IGPMAQSLFSCVQQIYSHAQHNSQTDRQLA-SIKKPGSRQTAARSLDSPRLDGYVLA 397 IGP Q +SCV +H+ H Q R ++ SI +PG A S+ L LA Sbjct: 291 IGPQDQGTYSCVA---THSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALA 344 >DQ104254-1|AAZ32415.1| 303|Homo sapiens receptor for advanced glycation end-products protein. Length = 303 Score = 30.7 bits (66), Expect = 4.3 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +2 Query: 230 IGPMAQSLFSCVQQIYSHAQHNSQTDRQLA-SIKKPGSRQTAARSLDSPRLDGYVLA 397 IGP Q +SCV +H+ H Q R ++ SI +PG A S+ L LA Sbjct: 190 IGPQDQGTYSCVA---THSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALA 243 >DQ104252-1|AAZ32413.1| 390|Homo sapiens receptor for advanced glycation end-products protein. Length = 390 Score = 30.7 bits (66), Expect = 4.3 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +2 Query: 230 IGPMAQSLFSCVQQIYSHAQHNSQTDRQLA-SIKKPGSRQTAARSLDSPRLDGYVLA 397 IGP Q +SCV +H+ H Q R ++ SI +PG A S+ L LA Sbjct: 277 IGPQDQGTYSCVA---THSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALA 330 >BX284686-16|CAM26224.1| 404|Homo sapiens advanced glycosylation end product-specific receptor protein. Length = 404 Score = 30.7 bits (66), Expect = 4.3 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +2 Query: 230 IGPMAQSLFSCVQQIYSHAQHNSQTDRQLA-SIKKPGSRQTAARSLDSPRLDGYVLA 397 IGP Q +SCV +H+ H Q R ++ SI +PG A S+ L LA Sbjct: 291 IGPQDQGTYSCVA---THSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALA 344 >BC020669-1|AAH20669.1| 404|Homo sapiens advanced glycosylation end product-specific receptor protein. Length = 404 Score = 30.7 bits (66), Expect = 4.3 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +2 Query: 230 IGPMAQSLFSCVQQIYSHAQHNSQTDRQLA-SIKKPGSRQTAARSLDSPRLDGYVLA 397 IGP Q +SCV +H+ H Q R ++ SI +PG A S+ L LA Sbjct: 291 IGPQDQGTYSCVA---THSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALA 344 >AY755624-1|AAX07277.1| 390|Homo sapiens receptor for advanced glycosylation end-products deletion exon 3 variant protein. Length = 390 Score = 30.7 bits (66), Expect = 4.3 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +2 Query: 230 IGPMAQSLFSCVQQIYSHAQHNSQTDRQLA-SIKKPGSRQTAARSLDSPRLDGYVLA 397 IGP Q +SCV +H+ H Q R ++ SI +PG A S+ L LA Sbjct: 277 IGPQDQGTYSCVA---THSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALA 330 >AY755621-1|AAX07274.1| 420|Homo sapiens receptor for advanced glycosylation end-products intron 4 variant protein. Length = 420 Score = 30.7 bits (66), Expect = 4.3 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +2 Query: 230 IGPMAQSLFSCVQQIYSHAQHNSQTDRQLA-SIKKPGSRQTAARSLDSPRLDGYVLA 397 IGP Q +SCV +H+ H Q R ++ SI +PG A S+ L LA Sbjct: 307 IGPQDQGTYSCVA---THSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALA 360 >AY755619-1|AAX07272.1| 404|Homo sapiens receptor for advanced glycosylation end-products protein. Length = 404 Score = 30.7 bits (66), Expect = 4.3 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +2 Query: 230 IGPMAQSLFSCVQQIYSHAQHNSQTDRQLA-SIKKPGSRQTAARSLDSPRLDGYVLA 397 IGP Q +SCV +H+ H Q R ++ SI +PG A S+ L LA Sbjct: 291 IGPQDQGTYSCVA---THSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALA 344 >AL845464-16|CAI41810.1| 404|Homo sapiens advanced glycosylation end product-specific receptor protein. Length = 404 Score = 30.7 bits (66), Expect = 4.3 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +2 Query: 230 IGPMAQSLFSCVQQIYSHAQHNSQTDRQLA-SIKKPGSRQTAARSLDSPRLDGYVLA 397 IGP Q +SCV +H+ H Q R ++ SI +PG A S+ L LA Sbjct: 291 IGPQDQGTYSCVA---THSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALA 344 >AL662884-21|CAI18354.1| 404|Homo sapiens advanced glycosylation end product-specific receptor protein. Length = 404 Score = 30.7 bits (66), Expect = 4.3 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +2 Query: 230 IGPMAQSLFSCVQQIYSHAQHNSQTDRQLA-SIKKPGSRQTAARSLDSPRLDGYVLA 397 IGP Q +SCV +H+ H Q R ++ SI +PG A S+ L LA Sbjct: 291 IGPQDQGTYSCVA---THSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALA 344 >AL662830-3|CAI17536.1| 404|Homo sapiens advanced glycosylation end product-specific receptor protein. Length = 404 Score = 30.7 bits (66), Expect = 4.3 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +2 Query: 230 IGPMAQSLFSCVQQIYSHAQHNSQTDRQLA-SIKKPGSRQTAARSLDSPRLDGYVLA 397 IGP Q +SCV +H+ H Q R ++ SI +PG A S+ L LA Sbjct: 291 IGPQDQGTYSCVA---THSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALA 344 >AB061669-1|BAC65466.1| 303|Homo sapiens N-terminal truncated form of receptor for advanced glycation endproducts protein. Length = 303 Score = 30.7 bits (66), Expect = 4.3 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +2 Query: 230 IGPMAQSLFSCVQQIYSHAQHNSQTDRQLA-SIKKPGSRQTAARSLDSPRLDGYVLA 397 IGP Q +SCV +H+ H Q R ++ SI +PG A S+ L LA Sbjct: 190 IGPQDQGTYSCVA---THSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALA 243 >AB036432-1|BAA89369.1| 404|Homo sapiens advanced glycation endproducts receptor protein. Length = 404 Score = 30.7 bits (66), Expect = 4.3 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +2 Query: 230 IGPMAQSLFSCVQQIYSHAQHNSQTDRQLA-SIKKPGSRQTAARSLDSPRLDGYVLA 397 IGP Q +SCV +H+ H Q R ++ SI +PG A S+ L LA Sbjct: 291 IGPQDQGTYSCVA---THSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALA 344 >BX284686-17|CAM26225.1| 347|Homo sapiens advanced glycosylation end product-specific receptor protein. Length = 347 Score = 29.9 bits (64), Expect = 7.6 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 2/51 (3%) Frame = +2 Query: 230 IGPMAQSLFSCVQQIYSHAQHNSQTDRQLA-SIKKPGSR-QTAARSLDSPR 376 IGP Q +SCV +H+ H Q R ++ SI +PG TA D R Sbjct: 291 IGPQDQGTYSCVA---THSSHGPQESRAVSISIIEPGEEGPTAGEGFDKVR 338 >AY755628-1|AAX07281.1| 347|Homo sapiens receptor for advanced glycosylation end-products intron 9 and deletion exon 11 protein. Length = 347 Score = 29.9 bits (64), Expect = 7.6 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 2/51 (3%) Frame = +2 Query: 230 IGPMAQSLFSCVQQIYSHAQHNSQTDRQLA-SIKKPGSR-QTAARSLDSPR 376 IGP Q +SCV +H+ H Q R ++ SI +PG TA D R Sbjct: 291 IGPQDQGTYSCVA---THSSHGPQESRAVSISIIEPGEEGPTAGEGFDKVR 338 >AY755622-1|AAX07275.1| 363|Homo sapiens receptor for advanced glycosylation end-products intron 4&9 variant protein. Length = 363 Score = 29.9 bits (64), Expect = 7.6 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 2/51 (3%) Frame = +2 Query: 230 IGPMAQSLFSCVQQIYSHAQHNSQTDRQLA-SIKKPGSR-QTAARSLDSPR 376 IGP Q +SCV +H+ H Q R ++ SI +PG TA D R Sbjct: 307 IGPQDQGTYSCVA---THSSHGPQESRAVSISIIEPGEEGPTAGEGFDKVR 354 >AY755620-1|AAX07273.1| 347|Homo sapiens receptor for advanced glycosylation end-products intron 9 variant protein. Length = 347 Score = 29.9 bits (64), Expect = 7.6 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 2/51 (3%) Frame = +2 Query: 230 IGPMAQSLFSCVQQIYSHAQHNSQTDRQLA-SIKKPGSR-QTAARSLDSPR 376 IGP Q +SCV +H+ H Q R ++ SI +PG TA D R Sbjct: 291 IGPQDQGTYSCVA---THSSHGPQESRAVSISIIEPGEEGPTAGEGFDKVR 338 >AL845464-17|CAM25716.1| 347|Homo sapiens advanced glycosylation end product-specific receptor protein. Length = 347 Score = 29.9 bits (64), Expect = 7.6 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 2/51 (3%) Frame = +2 Query: 230 IGPMAQSLFSCVQQIYSHAQHNSQTDRQLA-SIKKPGSR-QTAARSLDSPR 376 IGP Q +SCV +H+ H Q R ++ SI +PG TA D R Sbjct: 291 IGPQDQGTYSCVA---THSSHGPQESRAVSISIIEPGEEGPTAGEGFDKVR 338 >AL662884-22|CAM25647.1| 347|Homo sapiens advanced glycosylation end product-specific receptor protein. Length = 347 Score = 29.9 bits (64), Expect = 7.6 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 2/51 (3%) Frame = +2 Query: 230 IGPMAQSLFSCVQQIYSHAQHNSQTDRQLA-SIKKPGSR-QTAARSLDSPR 376 IGP Q +SCV +H+ H Q R ++ SI +PG TA D R Sbjct: 291 IGPQDQGTYSCVA---THSSHGPQESRAVSISIIEPGEEGPTAGEGFDKVR 338 >AL662830-4|CAM24893.1| 347|Homo sapiens advanced glycosylation end product-specific receptor protein. Length = 347 Score = 29.9 bits (64), Expect = 7.6 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 2/51 (3%) Frame = +2 Query: 230 IGPMAQSLFSCVQQIYSHAQHNSQTDRQLA-SIKKPGSR-QTAARSLDSPR 376 IGP Q +SCV +H+ H Q R ++ SI +PG TA D R Sbjct: 291 IGPQDQGTYSCVA---THSSHGPQESRAVSISIIEPGEEGPTAGEGFDKVR 338 >AF536237-1|AAQ10686.1| 147|Homo sapiens advanced glycosylation end product-specific receptor variant sRAGE2 protein. Length = 147 Score = 29.9 bits (64), Expect = 7.6 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 2/51 (3%) Frame = +2 Query: 230 IGPMAQSLFSCVQQIYSHAQHNSQTDRQLA-SIKKPGSR-QTAARSLDSPR 376 IGP Q +SCV +H+ H Q R ++ SI +PG TA D R Sbjct: 91 IGPQDQGTYSCVA---THSSHGPQESRAVSISIIEPGEEGPTAGEGFDKVR 138 >AB061668-1|BAC65465.1| 347|Homo sapiens soluble form of receptor for advanced glycation endproducts protein. Length = 347 Score = 29.9 bits (64), Expect = 7.6 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 2/51 (3%) Frame = +2 Query: 230 IGPMAQSLFSCVQQIYSHAQHNSQTDRQLA-SIKKPGSR-QTAARSLDSPR 376 IGP Q +SCV +H+ H Q R ++ SI +PG TA D R Sbjct: 291 IGPQDQGTYSCVA---THSSHGPQESRAVSISIIEPGEEGPTAGEGFDKVR 338 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 72,875,592 Number of Sequences: 237096 Number of extensions: 1326682 Number of successful extensions: 2723 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 2618 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2721 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6691573490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -