BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120248.Seq (806 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z48045-7|CAA88098.1| 329|Caenorhabditis elegans Hypothetical pr... 29 3.0 AC024205-3|AAF36045.1| 308|Caenorhabditis elegans Hypothetical ... 29 5.2 >Z48045-7|CAA88098.1| 329|Caenorhabditis elegans Hypothetical protein C41C4.1 protein. Length = 329 Score = 29.5 bits (63), Expect = 3.0 Identities = 16/55 (29%), Positives = 25/55 (45%) Frame = -1 Query: 317 THEKLLLTDDIVTEITSSLSKCPLFL*QLYPISNHLFHCDQLNNTPCFLEDHLQR 153 T +K+++ D + S S +F Q YP ++C N CFLE +R Sbjct: 149 TFKKIVVIRDPIARFISFFSNKCIFEAQKYPDRKQCYNCQ--GNVTCFLEKQYER 201 >AC024205-3|AAF36045.1| 308|Caenorhabditis elegans Hypothetical protein Y73C8B.2 protein. Length = 308 Score = 28.7 bits (61), Expect = 5.2 Identities = 15/55 (27%), Positives = 23/55 (41%) Frame = +2 Query: 59 RVVEPVLLKKKITLQEVEQMFWSIQTILCTDTVEGDPLKNMVYYLIGHNEINDSK 223 R+ EP LLKK + Q + F ++ + G P +V + ND K Sbjct: 8 RISEPKLLKKLVKFQAENEQFVELEAVYEDSITSGSPFGTVVAFHGSPGSHNDFK 62 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,050,488 Number of Sequences: 27780 Number of extensions: 325988 Number of successful extensions: 707 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 679 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 706 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1977346024 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -