BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120247X.Seq (623 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC101466-1|AAI01467.1| 1849|Homo sapiens SET binding factor 2 pr... 31 2.5 AY234241-1|AAO62733.1| 1849|Homo sapiens SET binding factor 2 pr... 31 2.5 AY517502-1|AAR98781.1| 143|Homo sapiens hypothetical protein pr... 31 4.4 >BC101466-1|AAI01467.1| 1849|Homo sapiens SET binding factor 2 protein. Length = 1849 Score = 31.5 bits (68), Expect = 2.5 Identities = 14/24 (58%), Positives = 18/24 (75%) Frame = -3 Query: 594 AVRESQLPVRIAACSRFNHLPVLC 523 AV++S LP R+A C R N LPV+C Sbjct: 1162 AVQDSSLP-RVARCYRHNRLPVVC 1184 >AY234241-1|AAO62733.1| 1849|Homo sapiens SET binding factor 2 protein. Length = 1849 Score = 31.5 bits (68), Expect = 2.5 Identities = 14/24 (58%), Positives = 18/24 (75%) Frame = -3 Query: 594 AVRESQLPVRIAACSRFNHLPVLC 523 AV++S LP R+A C R N LPV+C Sbjct: 1162 AVQDSSLP-RVARCYRHNRLPVVC 1184 >AY517502-1|AAR98781.1| 143|Homo sapiens hypothetical protein protein. Length = 143 Score = 30.7 bits (66), Expect = 4.4 Identities = 24/82 (29%), Positives = 34/82 (41%) Frame = -2 Query: 622 APQRARGGRCXSGKSTPRTHSRLQPVQPPSSFVCSQSIAFTLEGGDGIVVVFLRHNDGDD 443 APQ R G + R S L V P S ++ A+T+ G H Sbjct: 18 APQETRNGTADAASKEGRKSS-LPSVAPTGSASAAEDGAYTVRPSSG------PHGSQPF 70 Query: 442 APALVDDGRAGDVPVRRLEGRR 377 A++ GR + P+RRL+G R Sbjct: 71 TLAVLLRGRVFNTPIRRLDGGR 92 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 87,759,137 Number of Sequences: 237096 Number of extensions: 1794713 Number of successful extensions: 4423 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4264 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4417 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6747805200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -