BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120246.Seq (837 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_05_0209 - 23282848-23284110 32 0.65 03_01_0323 - 2522834-2523229,2524737-2524952 30 2.6 04_03_0927 + 20871487-20871903,20872667-20872812,20873204-208733... 29 3.5 10_02_0202 - 6770448-6770561,6771185-6771279,6771638-6771686,677... 29 4.6 08_02_1332 + 26207164-26207257,26207454-26207530,26207771-262078... 29 4.6 >05_05_0209 - 23282848-23284110 Length = 420 Score = 31.9 bits (69), Expect = 0.65 Identities = 17/35 (48%), Positives = 23/35 (65%), Gaps = 4/35 (11%) Frame = +3 Query: 285 MATFNEFEYLQYWFLLSFL---MSVALNAPTL-WT 377 MAT E+LQ+WF+LS L ++VALN + WT Sbjct: 260 MATILAVEFLQWWFMLSLLPEAIAVALNVAIMAWT 294 >03_01_0323 - 2522834-2523229,2524737-2524952 Length = 203 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/45 (26%), Positives = 23/45 (51%) Frame = +1 Query: 193 LSTDTKVKFPYAALSYINVTLAPTRPCWWDTWQHSTNLNIYNTGF 327 + T K + Y SYI + + + C+W W+ ++N + +GF Sbjct: 136 IDTSGKKEAIYTVYSYIAIGIILSLNCFWKVWREASNSDEKPSGF 180 >04_03_0927 + 20871487-20871903,20872667-20872812,20873204-20873301, 20873378-20873572,20873670-20873797,20873892-20874050, 20875119-20875223,20875449-20875559,20875653-20875790, 20875909-20876091,20876362-20876517,20876615-20876738, 20876820-20877030,20877614-20877729,20877828-20878053, 20878218-20878311,20879198-20879275,20879822-20879971, 20880086-20880292,20880584-20880788,20880990-20881096 Length = 1117 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = -2 Query: 473 KHHIIQQHVTKVHGLEQLHFVNYFMGFCGFERR 375 K + I QH+ ++H +L F+N F+ F G+ R Sbjct: 735 KSYDISQHLHEIHESVRLAFLNSFLDFAGYLER 767 >10_02_0202 - 6770448-6770561,6771185-6771279,6771638-6771686, 6771795-6771843,6772035-6772228 Length = 166 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +3 Query: 261 YTAMLVGYMATFNEFEYLQYWFLLSFLMSVALNAPTLWTA 380 + A+++G + YW LL L +V LN +WTA Sbjct: 53 FGAIVLGAPIGIKYWAATTYWSLLMSLFTVVLNVSAIWTA 92 >08_02_1332 + 26207164-26207257,26207454-26207530,26207771-26207841, 26208448-26208502,26209066-26209187,26209272-26209353, 26210070-26210160,26210759-26210982,26211294-26211413, 26211523-26211705 Length = 372 Score = 29.1 bits (62), Expect = 4.6 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 332 QQKPVL*IFKFVECCHVSH 276 +QKPVL + F+ CCH SH Sbjct: 97 RQKPVL--YTFINCCHTSH 113 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,072,279 Number of Sequences: 37544 Number of extensions: 377946 Number of successful extensions: 760 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 741 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 760 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2315199948 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -