BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120245.Seq (827 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146753-1|AAO12068.1| 311|Anopheles gambiae odorant-binding pr... 26 1.6 AY146750-1|AAO12065.1| 311|Anopheles gambiae odorant-binding pr... 26 1.6 AM182454-1|CAJ65692.1| 182|Anopheles gambiae globin 2 protein. 25 2.8 AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. 23 8.7 >AY146753-1|AAO12068.1| 311|Anopheles gambiae odorant-binding protein AgamOBP34 protein. Length = 311 Score = 25.8 bits (54), Expect = 1.6 Identities = 16/52 (30%), Positives = 29/52 (55%), Gaps = 1/52 (1%) Frame = -1 Query: 317 LSLGQTPLQTLSGRNEHRIYPSG*CG-CHFHSILTTTKYNMIKDWTESSRIY 165 L++ Q+ LQ+L+G +PSG C F+S +T + ++D + R+Y Sbjct: 178 LAVSQSTLQSLAGG----CFPSGEESLCFFYSFVTRSGLYSVEDGAKLERLY 225 >AY146750-1|AAO12065.1| 311|Anopheles gambiae odorant-binding protein AgamOBP37 protein. Length = 311 Score = 25.8 bits (54), Expect = 1.6 Identities = 16/52 (30%), Positives = 29/52 (55%), Gaps = 1/52 (1%) Frame = -1 Query: 317 LSLGQTPLQTLSGRNEHRIYPSG*CG-CHFHSILTTTKYNMIKDWTESSRIY 165 L++ Q+ LQ+L+G +PSG C F+S +T + ++D + R+Y Sbjct: 178 LAVSQSTLQSLAGG----CFPSGEESLCFFYSFVTRSGLYSVEDGAKLERLY 225 >AM182454-1|CAJ65692.1| 182|Anopheles gambiae globin 2 protein. Length = 182 Score = 25.0 bits (52), Expect = 2.8 Identities = 13/48 (27%), Positives = 26/48 (54%) Frame = +2 Query: 419 SYFDYTFDYNRE*LICNTLVFHKIINK*SLLKFFVYHLFKCMPLYQST 562 +YFD+T D N + L+ N ++ + I+ + + + FK L+ +T Sbjct: 45 AYFDFTDDPNAQSLVDNKSLYDQAIHVFKAVGALIEYGFKDPVLFDAT 92 >AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. Length = 679 Score = 23.4 bits (48), Expect = 8.7 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +2 Query: 320 HFGPINSLAFHPDG 361 H P++ LAFHP G Sbjct: 183 HLQPVHPLAFHPIG 196 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 858,836 Number of Sequences: 2352 Number of extensions: 17682 Number of successful extensions: 34 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 88150236 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -