BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= NV120243.Seq
(834 letters)
Database: spombe
5004 sequences; 2,362,478 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
SPCC1322.10 |||conserved fungal protein|Schizosaccharomyces pomb... 26 7.6
>SPCC1322.10 |||conserved fungal protein|Schizosaccharomyces
pombe|chr 3|||Manual
Length = 262
Score = 25.8 bits (54), Expect = 7.6
Identities = 14/37 (37%), Positives = 20/37 (54%)
Frame = +3
Query: 612 IVNGQYVSTSTASTNRRLSMPTKSSTMLQIAWQSRAT 722
I G Y STS +ST+ + P+ SST + S +T
Sbjct: 129 ISGGIYSSTSASSTSSSTATPSSSSTTSSSSSSSSST 165
Database: spombe
Posted date: Oct 4, 2007 10:57 AM
Number of letters in database: 2,362,478
Number of sequences in database: 5004
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,289,953
Number of Sequences: 5004
Number of extensions: 63948
Number of successful extensions: 165
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 163
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 165
length of database: 2,362,478
effective HSP length: 72
effective length of database: 2,002,190
effective search space used: 410448950
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -