BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120243.Seq (834 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF077534-9|AAC26286.1| 194|Caenorhabditis elegans Hypothetical ... 29 4.1 Z69385-1|CAA93424.2| 515|Caenorhabditis elegans Hypothetical pr... 29 5.4 >AF077534-9|AAC26286.1| 194|Caenorhabditis elegans Hypothetical protein K07D4.2 protein. Length = 194 Score = 29.1 bits (62), Expect = 4.1 Identities = 18/56 (32%), Positives = 33/56 (58%), Gaps = 3/56 (5%) Frame = -3 Query: 160 FGVQQRRGRIEMAL--DGSG-IKLYRRLGVLEQAQRRRGALGQHVFVKPILQSAAL 2 F V + +G MA D G I+ R+L ++QA ++G + +H+ +PI+++ AL Sbjct: 60 FYVGKGKGERAMAYFKDACGNIQGSRKLTTIDQAWNKKGFVYKHIIWRPIIENLAL 115 >Z69385-1|CAA93424.2| 515|Caenorhabditis elegans Hypothetical protein ZK593.1 protein. Length = 515 Score = 28.7 bits (61), Expect = 5.4 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 2/52 (3%) Frame = -1 Query: 753 MSTVCGCKYSGSPCFATLSGAWCWIWSACSNVDLY--LPSTWTRIARSQFTY 604 +S +CG + S P +G C I ACS+V+ + +T IAR F++ Sbjct: 18 ISHLCGLRISERPQKTRKTGVICTIGPACSDVETLRKMINTGMNIARLNFSH 69 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,859,098 Number of Sequences: 27780 Number of extensions: 382621 Number of successful extensions: 959 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 928 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 959 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 2072006206 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -