BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120242.Seq (763 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 25 0.66 EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hor... 24 1.2 DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hor... 24 1.2 AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle pr... 23 3.5 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 25.0 bits (52), Expect = 0.66 Identities = 10/31 (32%), Positives = 20/31 (64%) Frame = -3 Query: 164 CVQFLGGIVVVYLF*SGVEKVLQLPIIETLL 72 CV FLG I++ ++F + ++ + I +TL+ Sbjct: 235 CVFFLGSILIFFIFPLAILIIVYILIAKTLM 265 >EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 24.2 bits (50), Expect = 1.2 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +1 Query: 184 DCLTRSEIQALFREAINTLKHTMKQKTSARTCWT 285 D +TRS + L + + TLK T+ CWT Sbjct: 256 DSVTRSSLAFLGKAKVRTLKMTIIIVLVFFVCWT 289 >DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 24.2 bits (50), Expect = 1.2 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +1 Query: 184 DCLTRSEIQALFREAINTLKHTMKQKTSARTCWT 285 D +TRS + L + + TLK T+ CWT Sbjct: 256 DSVTRSSLAFLGKAKVRTLKMTIIIVLVFFVCWT 289 >AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle protein. Length = 361 Score = 22.6 bits (46), Expect = 3.5 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +3 Query: 381 HHKRIARLLGIKKIYHQEYKR 443 H A+L I++IYHQE ++ Sbjct: 144 HSDYRAKLAQIRQIYHQELEK 164 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 183,439 Number of Sequences: 336 Number of extensions: 4121 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20442493 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -