BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120242.Seq (763 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE013599-2836|AAM70845.1| 947|Drosophila melanogaster CG7097-PB... 29 6.9 AE013599-2835|AAF57595.1| 1218|Drosophila melanogaster CG7097-PA... 29 6.9 >AE013599-2836|AAM70845.1| 947|Drosophila melanogaster CG7097-PB, isoform B protein. Length = 947 Score = 29.1 bits (62), Expect = 6.9 Identities = 20/90 (22%), Positives = 37/90 (41%) Frame = +1 Query: 433 NTSGSFQRFTKIKHGKHAGATIFYRTAAVCKNEKLLNKLESSSYNKSNMDQLIAIVNFLE 612 N+S +Q + G+ + ++E N LE S S+MDQLI ++ + Sbjct: 455 NSSHLYQNLLRSSSGETPAGSSSAGNNCDYRHENNQNGLEDSPRRHSSMDQLIGLLENMG 514 Query: 613 KKNTNYILNVMPVMQDERKMSKRKEKVINN 702 K L+ D+ + + ++NN Sbjct: 515 KSPRTRSLSDGGTQDDDEAEKEAQPDLLNN 544 >AE013599-2835|AAF57595.1| 1218|Drosophila melanogaster CG7097-PA, isoform A protein. Length = 1218 Score = 29.1 bits (62), Expect = 6.9 Identities = 20/90 (22%), Positives = 37/90 (41%) Frame = +1 Query: 433 NTSGSFQRFTKIKHGKHAGATIFYRTAAVCKNEKLLNKLESSSYNKSNMDQLIAIVNFLE 612 N+S +Q + G+ + ++E N LE S S+MDQLI ++ + Sbjct: 726 NSSHLYQNLLRSSSGETPAGSSSAGNNCDYRHENNQNGLEDSPRRHSSMDQLIGLLENMG 785 Query: 613 KKNTNYILNVMPVMQDERKMSKRKEKVINN 702 K L+ D+ + + ++NN Sbjct: 786 KSPRTRSLSDGGTQDDDEAEKEAQPDLLNN 815 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 34,414,261 Number of Sequences: 53049 Number of extensions: 735365 Number of successful extensions: 1966 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1902 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1963 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3499501170 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -