BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120242.Seq (763 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex det... 25 0.77 DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex det... 25 0.77 DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex det... 25 0.77 DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex det... 25 0.77 DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex det... 25 0.77 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 25 1.0 DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 22 7.1 DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 22 7.1 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 22 7.1 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 22 7.1 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 22 7.1 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 22 7.1 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 22 7.1 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 22 7.1 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 22 7.1 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 22 7.1 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 22 7.1 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 21 9.4 >DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 25.0 bits (52), Expect = 0.77 Identities = 14/57 (24%), Positives = 26/57 (45%) Frame = +1 Query: 445 SFQRFTKIKHGKHAGATIFYRTAAVCKNEKLLNKLESSSYNKSNMDQLIAIVNFLEK 615 S++++ K + T R+ L N S+YN +N QL +N++E+ Sbjct: 55 SYRKYRKTSKERSRDRTERERSKEPKIISSLSNNYNYSNYNNNNYKQLCYNINYIEQ 111 >DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 25.0 bits (52), Expect = 0.77 Identities = 14/57 (24%), Positives = 26/57 (45%) Frame = +1 Query: 445 SFQRFTKIKHGKHAGATIFYRTAAVCKNEKLLNKLESSSYNKSNMDQLIAIVNFLEK 615 S++++ K + T R+ L N S+YN +N QL +N++E+ Sbjct: 55 SYRKYRKTSKERSRDRTERERSKEPKIISSLSNNYNYSNYNNNNYKQLCYNINYIEQ 111 >DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 25.0 bits (52), Expect = 0.77 Identities = 14/57 (24%), Positives = 26/57 (45%) Frame = +1 Query: 445 SFQRFTKIKHGKHAGATIFYRTAAVCKNEKLLNKLESSSYNKSNMDQLIAIVNFLEK 615 S++++ K + T R+ L N S+YN +N QL +N++E+ Sbjct: 55 SYRKYRKTSKERSRDRTERERSKEPKIISSLSNNYNYSNYNNNNYKQLCYNINYIEQ 111 >DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 25.0 bits (52), Expect = 0.77 Identities = 14/57 (24%), Positives = 26/57 (45%) Frame = +1 Query: 445 SFQRFTKIKHGKHAGATIFYRTAAVCKNEKLLNKLESSSYNKSNMDQLIAIVNFLEK 615 S++++ K + T R+ L N S+YN +N QL +N++E+ Sbjct: 55 SYRKYRKTSKERSRDRTERERSKEPKIISSLSNNYNYSNYNNNNYKQLCYNINYIEQ 111 >DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 25.0 bits (52), Expect = 0.77 Identities = 14/57 (24%), Positives = 26/57 (45%) Frame = +1 Query: 445 SFQRFTKIKHGKHAGATIFYRTAAVCKNEKLLNKLESSSYNKSNMDQLIAIVNFLEK 615 S++++ K + T R+ L N S+YN +N QL +N++E+ Sbjct: 55 SYRKYRKTSKERSRDRTERERSKEPKIISSLSNNYNYSNYNNNNYKQLCYNINYIEQ 111 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 24.6 bits (51), Expect = 1.0 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = -2 Query: 687 LLAFGHFAFVLHDRHYVEDIVSVLFFQEIYNSN 589 LL + H + D H E +VS++F N+N Sbjct: 218 LLLYNHARLMSQDNHSKEYLVSIMFSHYDRNNN 250 >DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 7.1 Identities = 7/20 (35%), Positives = 15/20 (75%) Frame = +1 Query: 556 SSYNKSNMDQLIAIVNFLEK 615 ++YNK N ++L +N++E+ Sbjct: 99 NNYNKHNYNKLYYNINYIEQ 118 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 7.1 Identities = 7/20 (35%), Positives = 15/20 (75%) Frame = +1 Query: 556 SSYNKSNMDQLIAIVNFLEK 615 ++YNK N ++L +N++E+ Sbjct: 99 NNYNKHNYNKLYYNINYIEQ 118 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 7.1 Identities = 7/20 (35%), Positives = 15/20 (75%) Frame = +1 Query: 556 SSYNKSNMDQLIAIVNFLEK 615 ++YNK N ++L +N++E+ Sbjct: 99 NNYNKHNYNKLYYNINYIEQ 118 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 7.1 Identities = 7/20 (35%), Positives = 15/20 (75%) Frame = +1 Query: 556 SSYNKSNMDQLIAIVNFLEK 615 ++YNK N ++L +N++E+ Sbjct: 99 NNYNKHNYNKLYYNINYIEQ 118 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 7.1 Identities = 7/20 (35%), Positives = 15/20 (75%) Frame = +1 Query: 556 SSYNKSNMDQLIAIVNFLEK 615 ++YNK N ++L +N++E+ Sbjct: 99 NNYNKHNYNKLYYNINYIEQ 118 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 7.1 Identities = 7/20 (35%), Positives = 15/20 (75%) Frame = +1 Query: 556 SSYNKSNMDQLIAIVNFLEK 615 ++YNK N ++L +N++E+ Sbjct: 99 NNYNKHNYNKLYYNINYIEQ 118 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 7.1 Identities = 7/20 (35%), Positives = 15/20 (75%) Frame = +1 Query: 556 SSYNKSNMDQLIAIVNFLEK 615 ++YNK N ++L +N++E+ Sbjct: 99 NNYNKHNYNKLYYNINYIEQ 118 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 7.1 Identities = 7/20 (35%), Positives = 15/20 (75%) Frame = +1 Query: 556 SSYNKSNMDQLIAIVNFLEK 615 ++YNK N ++L +N++E+ Sbjct: 99 NNYNKHNYNKLYYNINYIEQ 118 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 7.1 Identities = 7/20 (35%), Positives = 15/20 (75%) Frame = +1 Query: 556 SSYNKSNMDQLIAIVNFLEK 615 ++YNK N ++L +N++E+ Sbjct: 99 NNYNKHNYNKLYYNINYIEQ 118 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.8 bits (44), Expect = 7.1 Identities = 7/20 (35%), Positives = 15/20 (75%) Frame = +1 Query: 556 SSYNKSNMDQLIAIVNFLEK 615 ++YNK N ++L +N++E+ Sbjct: 332 NNYNKHNYNKLYYNINYIEQ 351 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.8 bits (44), Expect = 7.1 Identities = 7/20 (35%), Positives = 15/20 (75%) Frame = +1 Query: 556 SSYNKSNMDQLIAIVNFLEK 615 ++YNK N ++L +N++E+ Sbjct: 332 NNYNKHNYNKLYYNINYIEQ 351 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.4 bits (43), Expect = 9.4 Identities = 8/23 (34%), Positives = 12/23 (52%) Frame = +2 Query: 485 PEQQSSTELRPCAKMKSC*INWN 553 PE + ELRP + + + WN Sbjct: 1170 PEVELDRELRPYLRTAAAILTWN 1192 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 220,330 Number of Sequences: 438 Number of extensions: 4981 Number of successful extensions: 24 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 23789892 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -