BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120240.Seq (882 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z22181-4|CAA80182.1| 824|Caenorhabditis elegans Hypothetical pr... 31 1.4 U43283-3|AAC69024.2| 880|Caenorhabditis elegans Hypothetical pr... 28 7.7 >Z22181-4|CAA80182.1| 824|Caenorhabditis elegans Hypothetical protein ZK632.5 protein. Length = 824 Score = 30.7 bits (66), Expect = 1.4 Identities = 19/68 (27%), Positives = 34/68 (50%), Gaps = 4/68 (5%) Frame = +3 Query: 135 RFVAKDIASSLKYVNCERAIRVHVDGKYKSTFEHADQIQHML-QIAWQ---SRATRCICT 302 R +D +SLK V+ + + V +DG+YK +++ + Q+AW + TR + Sbjct: 93 RLSDEDFENSLKEVSLSQKLMVRIDGEYKYRLYSKPIVRNNIPQLAWDISPALRTRKVAE 152 Query: 303 HTQCSLPN 326 + S PN Sbjct: 153 KDEISPPN 160 >U43283-3|AAC69024.2| 880|Caenorhabditis elegans Hypothetical protein T25G12.6 protein. Length = 880 Score = 28.3 bits (60), Expect = 7.7 Identities = 17/38 (44%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +2 Query: 410 QVLCTGKYAP-AVEMDTN-DVIAKIDDLTQKLTVATQI 517 +V+ G P A +DT DV+ K DDLT T++TQI Sbjct: 837 KVIIVGLQLPDATHLDTLCDVLLKWDDLTNTETISTQI 874 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,216,924 Number of Sequences: 27780 Number of extensions: 443969 Number of successful extensions: 1287 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1207 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1287 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2223883816 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -