BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120238.Seq (852 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ138190-1|ABA03054.1| 135|Tribolium castaneum bursicon-like pr... 28 0.082 Z69742-1|CAA93624.1| 72|Tribolium castaneum arylphorin protein. 24 1.8 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 22 5.4 L01615-1|AAA30095.1| 69|Tribolium castaneum zinc finger protei... 22 5.4 >DQ138190-1|ABA03054.1| 135|Tribolium castaneum bursicon-like protein protein. Length = 135 Score = 28.3 bits (60), Expect = 0.082 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +1 Query: 337 MISYNLVKETGIEIPHSQDVCNDETAAQNCK 429 M NL+KE E+ Q +CN E A C+ Sbjct: 30 MSDINLIKEEFDELGRLQRICNGEVAVNKCE 60 >Z69742-1|CAA93624.1| 72|Tribolium castaneum arylphorin protein. Length = 72 Score = 23.8 bits (49), Expect = 1.8 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +2 Query: 512 HICDFVTIVGRKKVWVSFGQVVRNV 586 H+ + +V R VWVSF Q +NV Sbjct: 22 HMVGTIVVVVRG-VWVSFNQTAQNV 45 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 22.2 bits (45), Expect = 5.4 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = -3 Query: 586 YISYNLPKRNPHFLSPNDCNKVTNVVARNTYLN*NMKS 473 ++ Y+L RN P CNK + LN +MKS Sbjct: 245 HLEYHL--RNHAGSKPFQCNKCDYTCVNKSMLNSHMKS 280 >L01615-1|AAA30095.1| 69|Tribolium castaneum zinc finger protein protein. Length = 69 Score = 22.2 bits (45), Expect = 5.4 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = -3 Query: 586 YISYNLPKRNPHFLSPNDCNKVTNVVARNTYLN*NMKS 473 ++ Y+L RN P CNK + LN +MKS Sbjct: 3 HLEYHL--RNHAGSKPFQCNKCDYTCVNKSMLNSHMKS 38 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 200,465 Number of Sequences: 336 Number of extensions: 4501 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23555563 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -