BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120229.Seq (752 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g07687.1 68415.m00937 cytochrome c oxidase subunit 3 identica... 123 1e-28 >At2g07687.1 68415.m00937 cytochrome c oxidase subunit 3 identical to cytochrome c oxidase subunit 3 (GI:15215914) [Arabidopsis thaliana]; similar to Cytochrome c oxidase polypeptide III (EC 1.9.3.1) (Swiss-Prot:P92514) [Arabidopsis thaliana] Length = 265 Score = 123 bits (297), Expect = 1e-28 Identities = 57/95 (60%), Positives = 70/95 (73%) Frame = +2 Query: 446 IIFNYFIRILFYYFTSI*IYRASFTIADRIYGSTFFIATGFHGIHVIIGTLFLLICYIRH 625 ++ + ++F F + Y+A FTI+D IYGSTFF+ATGFHG HVIIGTLFL+IC IR Sbjct: 166 LVATVLLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIGTLFLIICGIRQ 225 Query: 626 LNNHFSKNHHFGFEAAA*Y*HFVDVV*LFLYISIY 730 H +K HH GFEAAA Y HFVDVV LFL++SIY Sbjct: 226 YLGHLTKEHHVGFEAAAWYWHFVDVVWLFLFVSIY 260 Score = 59.7 bits (138), Expect = 2e-09 Identities = 30/69 (43%), Positives = 40/69 (57%) Frame = +3 Query: 276 LSPNIEIGRI*PPSRITPFNPFQIPLLNTIILIRSGVTVT*AHHSLIENNFSQTKQRLFL 455 L+P +EIG I PP I +P++IP LNT IL SG VT AHH+++ + L Sbjct: 109 LAPAVEIGGIWPPKGIEVLDPWEIPFLNTPILPSSGAAVTWAHHAILAGKEKRAVYALVA 168 Query: 456 TILLGFYFT 482 T+LL FT Sbjct: 169 TVLLALVFT 177 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,808,200 Number of Sequences: 28952 Number of extensions: 159772 Number of successful extensions: 248 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 245 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 248 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1672953192 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -