Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120228.Seq
         (783 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF274024-1|AAF90150.1|  232|Apis mellifera tetraspanin F139 prot...    23   2.4  
EF493864-1|ABP65286.1|  247|Apis mellifera triosephoshpate isome...    23   3.2  

>AF274024-1|AAF90150.1|  232|Apis mellifera tetraspanin F139
           protein.
          Length = 232

 Score = 23.4 bits (48), Expect = 2.4
 Identities = 12/41 (29%), Positives = 20/41 (48%), Gaps = 5/41 (12%)
 Frame = -3

Query: 628 CCASTKSNSCS-----SDCCSFLTVSTASFSSTIFSPFAIS 521
           CC S ++N+CS     ++ C      T   + T+F   AI+
Sbjct: 163 CCNSPENNTCSISNSYTNGCVEALKDTVKLAGTVFGSVAIA 203


>EF493864-1|ABP65286.1|  247|Apis mellifera triosephoshpate
           isomerase protein.
          Length = 247

 Score = 23.0 bits (47), Expect = 3.2
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = +3

Query: 288 IHYHPVWHNGTGK 326
           + Y PVW  GTGK
Sbjct: 161 VAYEPVWAIGTGK 173


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 201,789
Number of Sequences: 438
Number of extensions: 4172
Number of successful extensions: 5
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 24639531
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)