BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120227.Seq (564 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 23 2.4 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 23 2.4 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 23 2.4 AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain tran... 23 2.4 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 23 2.4 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 23 2.4 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 23 2.4 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 23 2.4 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 23 2.4 AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia or... 23 2.4 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 22 4.2 AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 21 5.5 DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. 21 7.3 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 21 7.3 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.6 bits (46), Expect = 2.4 Identities = 12/55 (21%), Positives = 22/55 (40%) Frame = +2 Query: 65 HRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPDPLIKVNDSIQLDIAT 229 H + P Y + +R+A+ P TH + +Y D + D++T Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASPQDLST 118 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.6 bits (46), Expect = 2.4 Identities = 12/55 (21%), Positives = 22/55 (40%) Frame = +2 Query: 65 HRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPDPLIKVNDSIQLDIAT 229 H + P Y + +R+A+ P TH + +Y D + D++T Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASPQDLST 118 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 22.6 bits (46), Expect = 2.4 Identities = 12/55 (21%), Positives = 22/55 (40%) Frame = +2 Query: 65 HRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPDPLIKVNDSIQLDIAT 229 H + P Y + +R+A+ P TH + +Y D + D++T Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASPQDLST 118 >AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain transcription factor Maxillopediaprotein. Length = 523 Score = 22.6 bits (46), Expect = 2.4 Identities = 11/36 (30%), Positives = 14/36 (38%) Frame = +3 Query: 360 QGLHGTHLRHEVEQRVHNRQGHEGVHLAAARQGHPP 467 QG G H + ++ G E HL GH P Sbjct: 379 QGYQGEHPNYNHYGYHYSGDGGEVAHLPNTHMGHEP 414 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.6 bits (46), Expect = 2.4 Identities = 12/55 (21%), Positives = 22/55 (40%) Frame = +2 Query: 65 HRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPDPLIKVNDSIQLDIAT 229 H + P Y + +R+A+ P TH + +Y D + D++T Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASPQDLST 118 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 22.6 bits (46), Expect = 2.4 Identities = 12/55 (21%), Positives = 22/55 (40%) Frame = +2 Query: 65 HRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPDPLIKVNDSIQLDIAT 229 H + P Y + +R+A+ P TH + +Y D + D++T Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASPQDLST 118 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 22.6 bits (46), Expect = 2.4 Identities = 12/55 (21%), Positives = 22/55 (40%) Frame = +2 Query: 65 HRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPDPLIKVNDSIQLDIAT 229 H + P Y + +R+A+ P TH + +Y D + D++T Sbjct: 20 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASPQDLST 74 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 22.6 bits (46), Expect = 2.4 Identities = 12/55 (21%), Positives = 22/55 (40%) Frame = +2 Query: 65 HRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPDPLIKVNDSIQLDIAT 229 H + P Y + +R+A+ P TH + +Y D + D++T Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASPQDLST 118 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 22.6 bits (46), Expect = 2.4 Identities = 12/55 (21%), Positives = 22/55 (40%) Frame = +2 Query: 65 HRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPDPLIKVNDSIQLDIAT 229 H + P Y + +R+A+ P TH + +Y D + D++T Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASPQDLST 118 >AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia ortholog protein. Length = 471 Score = 22.6 bits (46), Expect = 2.4 Identities = 11/36 (30%), Positives = 14/36 (38%) Frame = +3 Query: 360 QGLHGTHLRHEVEQRVHNRQGHEGVHLAAARQGHPP 467 QG G H + ++ G E HL GH P Sbjct: 327 QGYQGEHPNYNHYGYHYSGDGGEVAHLPNTHMGHEP 362 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 21.8 bits (44), Expect = 4.2 Identities = 12/55 (21%), Positives = 21/55 (38%) Frame = +2 Query: 65 HRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPDPLIKVNDSIQLDIAT 229 H + P Y + +R+A P TH + +Y D + D++T Sbjct: 64 HGLQPTMGDYTQLQPQRLAPTHLQSPNTQTHPSASCKYADSTSSTGVASPQDLST 118 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 21.4 bits (43), Expect = 5.5 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +3 Query: 450 RQGHPPHH 473 RQG PPHH Sbjct: 57 RQGIPPHH 64 >DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. Length = 305 Score = 21.0 bits (42), Expect = 7.3 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = -2 Query: 377 CPVESLMCTMSKEPGCLSRDTMVPTRPKLR 288 C V+S +K GC S ++ V T LR Sbjct: 95 CSVKSESSQAAKYGGCFSGESTVLTSTGLR 124 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 21.0 bits (42), Expect = 7.3 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = +3 Query: 81 RRLSTSCVKSSVWRPDLRMFR 143 R+++ C+KS WR L + + Sbjct: 525 RKVTFQCLKSIAWRAFLAVLK 545 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 137,123 Number of Sequences: 336 Number of extensions: 3308 Number of successful extensions: 14 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 13890653 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -