BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120226.Seq (859 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC56E4.05 |mug69||DUF788 family protein|Schizosaccharomyces po... 26 6.0 SPCC16A11.16c |||ARM1 family|Schizosaccharomyces pombe|chr 3|||M... 26 7.9 >SPAC56E4.05 |mug69||DUF788 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 192 Score = 26.2 bits (55), Expect = 6.0 Identities = 13/26 (50%), Positives = 18/26 (69%), Gaps = 1/26 (3%) Frame = +2 Query: 71 RHGLH-LSKFKNAFASVSTTFVHHPI 145 R GL SKF AFAS+S+ F+H+ + Sbjct: 39 RSGLSKFSKFVYAFASISSGFLHYQL 64 >SPCC16A11.16c |||ARM1 family|Schizosaccharomyces pombe|chr 3|||Manual Length = 388 Score = 25.8 bits (54), Expect = 7.9 Identities = 9/36 (25%), Positives = 20/36 (55%) Frame = -3 Query: 239 QNQNGRSVNVHHVFDRVMTRSARIVDHFSMFRWDGE 132 Q+ +G + +H ++DR++ ++ H + DGE Sbjct: 336 QSASGAELFLHALYDRLVNEGVIVISHITQEGSDGE 371 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,009,522 Number of Sequences: 5004 Number of extensions: 57090 Number of successful extensions: 183 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 179 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 183 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 426466470 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -