BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120226.Seq (859 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_04_0496 + 18079905-18081586,18084825-18084868,18086396-180865... 32 0.67 09_02_0250 + 6266818-6267029,6267230-6267287,6267999-6268118,627... 30 2.1 01_06_1593 + 38502884-38502993,38503580-38503665,38504352-385044... 30 2.7 01_06_1729 + 39486553-39487413,39487953-39488020,39489574-394901... 29 3.6 05_03_0511 + 14907475-14907933,14907948-14908178,14908520-149088... 29 6.3 01_06_1121 - 34657505-34658161 28 8.3 >09_04_0496 + 18079905-18081586,18084825-18084868,18086396-18086502, 18087069-18087674,18087789-18088013,18088102-18088167, 18088268-18088336,18088511-18088582,18088672-18088848, 18089978-18090115 Length = 1061 Score = 31.9 bits (69), Expect = 0.67 Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = +3 Query: 177 GSCHNTVKYMVDIYGASVLILRTPCS-LPTS 266 G CHN VK + IYG + L+L P LPT+ Sbjct: 546 GDCHNAVKLLSKIYGRNPLLLLAPDGPLPTA 576 >09_02_0250 + 6266818-6267029,6267230-6267287,6267999-6268118, 6272359-6272511,6273381-6273586,6274280-6274733, 6276573-6276610,6276923-6277046,6277184-6277246, 6277350-6277412,6277526-6278152,6278267-6278294, 6278373-6278413,6278689-6278851,6278987-6279039, 6279217-6279262,6279373-6279444,6279578-6279741, 6279968-6280099,6280249-6280565,6280721-6280892, 6281009-6281107,6281275-6281349,6281446-6281504, 6281647-6281836,6281982-6282020 Length = 1255 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = -3 Query: 713 IVLMASNNCSANLSNMSVKSGNESVISESNVFN 615 +V + SN CS NMS+KS E + ++SN F+ Sbjct: 944 VVCLGSNTCSNKTKNMSIKS--EHIYNKSNQFD 974 >01_06_1593 + 38502884-38502993,38503580-38503665,38504352-38504497, 38504817-38504933,38505028-38505144,38505858-38506001, 38506099-38506251 Length = 290 Score = 29.9 bits (64), Expect = 2.7 Identities = 17/60 (28%), Positives = 29/60 (48%) Frame = +1 Query: 556 NQNVQLLAALETAKDVILTRLNTLLSEITDSLPDLTLMLDKLAEQLLEAINTMQQTQRNE 735 N+ + +L E D+I TRLN ++ + D L + +D +Q L + + T R E Sbjct: 206 NEPLHVLVEAEFPADIIDTRLNQAVTILEDLLKPIDESMDYYKKQQLRELAILNGTLREE 265 >01_06_1729 + 39486553-39487413,39487953-39488020,39489574-39490154, 39490623-39491432,39491738-39493035 Length = 1205 Score = 29.5 bits (63), Expect = 3.6 Identities = 25/92 (27%), Positives = 41/92 (44%), Gaps = 4/92 (4%) Frame = +1 Query: 412 SQARTATNIRRAGKNSSSKRHVDEQRQPNKSQQTNQFLELSNVMTGVRNQN-VQLLAALE 588 SQ ++ N+ G SS ++R +++ N +SN GVR +N QL L Sbjct: 558 SQPNSSNNVGCVGTKLSSSSTERQERPSSQNAHCNGSSVISNGPKGVRTRNKYQLKMVLS 617 Query: 589 ---TAKDVILTRLNTLLSEITDSLPDLTLMLD 675 AKD+ + + SE + S D+ +D Sbjct: 618 EGFQAKDIYSAKEKKVQSEPSSSKGDVKETID 649 >05_03_0511 + 14907475-14907933,14907948-14908178,14908520-14908855, 14909571-14910126,14910217-14910424,14910519-14910885, 14910988-14911110 Length = 759 Score = 28.7 bits (61), Expect = 6.3 Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 1/64 (1%) Frame = +1 Query: 466 KRHVDEQR-QPNKSQQTNQFLELSNVMTGVRNQNVQLLAALETAKDVILTRLNTLLSEIT 642 K +DEQR Q + + + + +EL ++T + V++ L T D+ LSE+ Sbjct: 171 KVFLDEQRGQSSSAVRRARAVELRTILTRLGPTFVKIGQGLSTRPDLCPPEYLEELSELQ 230 Query: 643 DSLP 654 DSLP Sbjct: 231 DSLP 234 >01_06_1121 - 34657505-34658161 Length = 218 Score = 28.3 bits (60), Expect = 8.3 Identities = 15/52 (28%), Positives = 21/52 (40%) Frame = +3 Query: 105 PLQAFQQLLFTIPSKHRKMINDAGGSCHNTVKYMVDIYGASVLILRTPCSLP 260 P A + L H + DA ++ M G +VLI R+PC P Sbjct: 150 PAPAARSALLAAAGAHPVELGDAHRELEAELRKMAPPNGRTVLIFRSPCGCP 201 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,259,519 Number of Sequences: 37544 Number of extensions: 368737 Number of successful extensions: 1126 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1080 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1126 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2397465936 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -