BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120224.Seq (743 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 26 1.4 AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific tran... 26 1.4 AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-s... 26 1.4 AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. 26 1.4 AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transc... 26 1.4 AF185643-1|AAF15578.1| 117|Anopheles gambiae Toll-related prote... 26 1.4 AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase pr... 25 2.5 AJ459962-1|CAD31061.1| 685|Anopheles gambiae prophenoloxidase 9... 25 3.3 AF487534-1|AAL93295.1| 509|Anopheles gambiae cytochrome P450 CY... 24 4.3 AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subu... 23 7.5 AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein ... 23 10.0 AY146723-1|AAO12083.1| 155|Anopheles gambiae odorant-binding pr... 23 10.0 AY146721-1|AAO12081.1| 144|Anopheles gambiae odorant-binding pr... 23 10.0 AF437884-1|AAL84179.1| 144|Anopheles gambiae odorant binding pr... 23 10.0 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 25.8 bits (54), Expect = 1.4 Identities = 10/39 (25%), Positives = 18/39 (46%) Frame = +2 Query: 131 RQRNKTAAPPRTQHDSRHRHPVAADSGPVHRKRVHRTHH 247 +Q+ + + QH S H+ H++ H+THH Sbjct: 246 QQQQQQTHHQQQQHPSSHQQQSQQHPSSQHQQPTHQTHH 284 Score = 24.6 bits (51), Expect = 3.3 Identities = 8/30 (26%), Positives = 12/30 (40%) Frame = +2 Query: 158 PRTQHDSRHRHPVAADSGPVHRKRVHRTHH 247 P + +HP + P H+ H HH Sbjct: 260 PSSHQQQSQQHPSSQHQQPTHQTHHHHHHH 289 >AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific transcription factor FRU-MB protein. Length = 759 Score = 25.8 bits (54), Expect = 1.4 Identities = 10/39 (25%), Positives = 18/39 (46%) Frame = +2 Query: 131 RQRNKTAAPPRTQHDSRHRHPVAADSGPVHRKRVHRTHH 247 +Q+ + + QH S H+ H++ H+THH Sbjct: 246 QQQQQQTHHQQQQHPSSHQQQSQQHPSSQHQQPTHQTHH 284 Score = 24.6 bits (51), Expect = 3.3 Identities = 8/30 (26%), Positives = 12/30 (40%) Frame = +2 Query: 158 PRTQHDSRHRHPVAADSGPVHRKRVHRTHH 247 P + +HP + P H+ H HH Sbjct: 260 PSSHQQQSQQHPSSQHQQPTHQTHHHHHHH 289 >AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-specific zinc-fingerC isoform protein. Length = 593 Score = 25.8 bits (54), Expect = 1.4 Identities = 10/39 (25%), Positives = 18/39 (46%) Frame = +2 Query: 131 RQRNKTAAPPRTQHDSRHRHPVAADSGPVHRKRVHRTHH 247 +Q+ + + QH S H+ H++ H+THH Sbjct: 198 QQQQQQTHHQQQQHPSSHQQQSQQHPSSQHQQPTHQTHH 236 Score = 24.6 bits (51), Expect = 3.3 Identities = 8/30 (26%), Positives = 12/30 (40%) Frame = +2 Query: 158 PRTQHDSRHRHPVAADSGPVHRKRVHRTHH 247 P + +HP + P H+ H HH Sbjct: 212 PSSHQQQSQQHPSSQHQQPTHQTHHHHHHH 241 >AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. Length = 1356 Score = 25.8 bits (54), Expect = 1.4 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +1 Query: 259 ETEKRRFGRRIQHHSIKRERAQRGICSLVSSTPNK 363 ++E RF + HH + R+R +R I L+ P K Sbjct: 1152 KSEWCRFEFKSAHHQVLRDRRRRLIVILLGEVPQK 1186 >AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transcription factor pannier protein. Length = 537 Score = 25.8 bits (54), Expect = 1.4 Identities = 10/25 (40%), Positives = 11/25 (44%) Frame = +2 Query: 152 APPRTQHDSRHRHPVAADSGPVHRK 226 A P H H HP AAD H + Sbjct: 500 AHPHHHHHHHHHHPTAADLAGYHHQ 524 >AF185643-1|AAF15578.1| 117|Anopheles gambiae Toll-related protein protein. Length = 117 Score = 25.8 bits (54), Expect = 1.4 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +1 Query: 259 ETEKRRFGRRIQHHSIKRERAQRGICSLVSSTPNK 363 ++E RF + HH + R+R +R I L+ P K Sbjct: 66 KSEWCRFEFKSAHHQVLRDRRRRLIVILLGEVPQK 100 >AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase protein. Length = 1253 Score = 25.0 bits (52), Expect = 2.5 Identities = 10/37 (27%), Positives = 19/37 (51%) Frame = +3 Query: 189 IPSLLIAALFIGNAFIVLIIYKTGNGKTTIWKTNSTP 299 +P+ L+ + I + +++L+IY N W T P Sbjct: 688 LPAGLVYYITIPSMYMLLVIYSVFNMNDVSWGTRENP 724 >AJ459962-1|CAD31061.1| 685|Anopheles gambiae prophenoloxidase 9 protein. Length = 685 Score = 24.6 bits (51), Expect = 3.3 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -2 Query: 139 SLPMPSREESFPTALTTVSVFPRHV 65 ++P+PS E FPT ++FP+ V Sbjct: 141 NVPVPSFLEMFPTRFVDPALFPKLV 165 >AF487534-1|AAL93295.1| 509|Anopheles gambiae cytochrome P450 CYP6P3 protein. Length = 509 Score = 24.2 bits (50), Expect = 4.3 Identities = 12/34 (35%), Positives = 15/34 (44%) Frame = +3 Query: 201 LIAALFIGNAFIVLIIYKTGNGKTTIWKTNSTPF 302 LI A+ F V I+Y K WK N P+ Sbjct: 3 LINAVLAAFIFAVSIVYLFIRNKHNYWKDNGFPY 36 >AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subunit protein. Length = 837 Score = 23.4 bits (48), Expect = 7.5 Identities = 16/36 (44%), Positives = 21/36 (58%) Frame = -2 Query: 124 SREESFPTALTTVSVFPRHVSLKLRRSYFEPERYNV 17 S ES A + V + P+ VSLKLR + E R+NV Sbjct: 130 SSYESESGAGSIVQISPQRVSLKLRLN--EAFRFNV 163 >AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein protein. Length = 699 Score = 23.0 bits (47), Expect = 10.0 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = -1 Query: 587 VIYYRFLNYLMDVIIHKNLPLQSLYL*RNPHRNPLRSFKDLSIHRDI 447 V++Y FL YL V ++ +P YL + +PL K +S+ R + Sbjct: 263 VLFYEFLPYLAIVCMNLVVPQLFNYLVQYEKYSPLFVIK-ISLFRTV 308 >AY146723-1|AAO12083.1| 155|Anopheles gambiae odorant-binding protein AgamOBP17 protein. Length = 155 Score = 23.0 bits (47), Expect = 10.0 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +3 Query: 57 LSDTCLGKTETVVKAVGNDSSREGIGKETKL 149 L D CLGKT +A+ S E I ++ KL Sbjct: 41 LHDICLGKTGVTEEAIKKFSDEE-IHEDEKL 70 >AY146721-1|AAO12081.1| 144|Anopheles gambiae odorant-binding protein AgamOBP1 protein. Length = 144 Score = 23.0 bits (47), Expect = 10.0 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +3 Query: 57 LSDTCLGKTETVVKAVGNDSSREGIGKETKL 149 L D CLGKT +A+ S E I ++ KL Sbjct: 41 LHDICLGKTGVTEEAIKKFSDEE-IHEDEKL 70 >AF437884-1|AAL84179.1| 144|Anopheles gambiae odorant binding protein protein. Length = 144 Score = 23.0 bits (47), Expect = 10.0 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +3 Query: 57 LSDTCLGKTETVVKAVGNDSSREGIGKETKL 149 L D CLGKT +A+ S E I ++ KL Sbjct: 41 LHDICLGKTGVTEEAIKKFSDEE-IHEDEKL 70 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 720,050 Number of Sequences: 2352 Number of extensions: 13662 Number of successful extensions: 32 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76507752 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -