BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120224.Seq (743 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g55100.2 68418.m06869 SWAP (Suppressor-of-White-APricot)/surp... 30 1.4 At5g55100.1 68418.m06868 SWAP (Suppressor-of-White-APricot)/surp... 30 1.4 At5g25060.1 68418.m02970 RNA recognition motif (RRM)-containing ... 28 5.7 >At5g55100.2 68418.m06869 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein contains Pfam domain PF01805: Surp module Length = 844 Score = 30.3 bits (65), Expect = 1.4 Identities = 25/88 (28%), Positives = 38/88 (43%), Gaps = 6/88 (6%) Frame = +2 Query: 44 RTSEFERHVSWKNRDGCQSRRERLFTGGHRQRNKTAAPPRTQHDS-----RHRHPVAADS 208 R S +RH K++ S E HR R+ ++ +DS HRH + S Sbjct: 666 RYSSKDRHSRDKHKHESSSDDEYHSRSRHRHRHSKSSDRHELYDSSDNEGEHRHRSSKHS 725 Query: 209 GPVHRKRVHRTHHL*NRK-RKNDDLEDE 289 V + R+HH +RK K+ D D+ Sbjct: 726 KDVDYSKDKRSHHHRSRKHEKHRDSSDD 753 >At5g55100.1 68418.m06868 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein contains Pfam domain PF01805: Surp module Length = 843 Score = 30.3 bits (65), Expect = 1.4 Identities = 25/88 (28%), Positives = 38/88 (43%), Gaps = 6/88 (6%) Frame = +2 Query: 44 RTSEFERHVSWKNRDGCQSRRERLFTGGHRQRNKTAAPPRTQHDS-----RHRHPVAADS 208 R S +RH K++ S E HR R+ ++ +DS HRH + S Sbjct: 666 RYSSKDRHSRDKHKHESSSDDEYHSRSRHRHRHSKSSDRHELYDSSDNEGEHRHRSSKHS 725 Query: 209 GPVHRKRVHRTHHL*NRK-RKNDDLEDE 289 V + R+HH +RK K+ D D+ Sbjct: 726 KDVDYSKDKRSHHHRSRKHEKHRDSSDD 753 >At5g25060.1 68418.m02970 RNA recognition motif (RRM)-containing protein KIAA0332 - Homo sapiens, EMBL:AB002330 Length = 946 Score = 28.3 bits (60), Expect = 5.7 Identities = 19/63 (30%), Positives = 26/63 (41%) Frame = +2 Query: 77 KNRDGCQSRRERLFTGGHRQRNKTAAPPRTQHDSRHRHPVAADSGPVHRKRVHRTHHL*N 256 K D +S ++R HR NK+ +PPR H + D + R H L N Sbjct: 860 KREDSQESSKKR-----HRGENKSQSPPRKSSTRERDHDLGRDRDRERHRDRDRQHDL-N 913 Query: 257 RKR 265 R R Sbjct: 914 RDR 916 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,953,007 Number of Sequences: 28952 Number of extensions: 291841 Number of successful extensions: 730 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 715 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 729 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1643603136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -