BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120223.Seq (854 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_06_0113 + 20938357-20938730,20938820-20939057,20939140-209392... 29 3.6 >09_06_0113 + 20938357-20938730,20938820-20939057,20939140-20939264, 20939682-20939715,20939804-20939850,20939948-20940079, 20940420-20940484,20940613-20940685,20940790-20940946 Length = 414 Score = 29.5 bits (63), Expect = 3.6 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 5/36 (13%) Frame = -3 Query: 720 LNPRKGNL-----SISNRKYDHGKTTIKGGNYKSVS 628 +N RKG+ S S++KY G+ +KGGN+K S Sbjct: 244 INKRKGSYCKFHSSKSSQKYSTGRVELKGGNFKFAS 279 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,310,305 Number of Sequences: 37544 Number of extensions: 376942 Number of successful extensions: 708 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 693 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 708 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2385713652 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -