BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120223.Seq (854 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF040653-10|AAB95029.1| 580|Caenorhabditis elegans F-box b prot... 31 1.4 U55372-2|AAA98001.1| 980|Caenorhabditis elegans Hypothetical pr... 28 7.4 >AF040653-10|AAB95029.1| 580|Caenorhabditis elegans F-box b protein protein 49 protein. Length = 580 Score = 30.7 bits (66), Expect = 1.4 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = -3 Query: 744 FLKHRLQVLNPRKGNLSISNRKYDHGKTTI-KGGNYKSVSLQERIFQI 604 FLKH + L P LSI N + D ++TI KG +Y+ + + I Sbjct: 490 FLKHWMAGLKPELKYLSIENEEQDFDQSTILKGIHYEFAPIDRKFLMI 537 >U55372-2|AAA98001.1| 980|Caenorhabditis elegans Hypothetical protein C02G6.1 protein. Length = 980 Score = 28.3 bits (60), Expect = 7.4 Identities = 15/34 (44%), Positives = 18/34 (52%) Frame = +1 Query: 457 HPSLTTLLFQY*KKMPLLAKRQATFCCFNFNICR 558 H SLT ++ Y +K PL K T C NF I R Sbjct: 579 HASLTLHVYGYDEKQPLFVK-HLTSCMINFKIDR 611 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,424,909 Number of Sequences: 27780 Number of extensions: 371204 Number of successful extensions: 792 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 765 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 792 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2129473654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -