BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120222.Seq (736 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC613.09 |sen54||tRNA-splicing endonuclease subunit Sen54 |Sch... 29 0.69 SPAC22H12.05c |||fasciclin domain protein |Schizosaccharomyces p... 27 2.1 SPAC22H10.12c |gdi1|sec19|GDP dissociation inhibitor Gdi1 |Schiz... 27 2.8 SPCC1223.06 |tea1|alp8|cell end marker Tea1|Schizosaccharomyces ... 26 4.8 SPBC29A3.02c |his7||phosphoribosyl-AMP cyclohydrolase/phosphorib... 26 6.4 SPAC3F10.09 |||1-|Schizosaccharomyces pombe|chr 1|||Manual 26 6.4 SPAC17A5.15c |||glutamate-tRNA ligase |Schizosaccharomyces pombe... 25 8.5 >SPCC613.09 |sen54||tRNA-splicing endonuclease subunit Sen54 |Schizosaccharomyces pombe|chr 3|||Manual Length = 384 Score = 29.1 bits (62), Expect = 0.69 Identities = 13/52 (25%), Positives = 30/52 (57%) Frame = -2 Query: 387 ILPSRFSVASSHNHFVGKQNERSVGFRQICVGHRQFLRQIVNFGITSFVSIS 232 +LP+ F + + + +QN F+++ G+R + IV++G+ S++ +S Sbjct: 303 LLPTIFEIDALFSSTPLRQNMPQHMFQRLKEGYRNIIIAIVDYGVISYIRLS 354 >SPAC22H12.05c |||fasciclin domain protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 728 Score = 27.5 bits (58), Expect = 2.1 Identities = 9/27 (33%), Positives = 19/27 (70%) Frame = +1 Query: 100 LITKSGVIQLIMKSKLPYAIELQEWLL 180 L+ K GV+ L+ K KLP+++ ++ ++ Sbjct: 542 LLVKDGVVHLVDKVKLPFSVSQKDMII 568 >SPAC22H10.12c |gdi1|sec19|GDP dissociation inhibitor Gdi1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 440 Score = 27.1 bits (57), Expect = 2.8 Identities = 16/53 (30%), Positives = 31/53 (58%) Frame = +3 Query: 522 AFLRPQKRSLGRSLKRLGSNDVIFSSDYVPNSMNVLNKVKEAIPRNKFKAKHN 680 ++ R + RS+GR ++ + + +PN+ N L+ V+ IP+N+ K KH+ Sbjct: 285 SYFREKVRSVGRLVRA-----ICILNHPIPNTDN-LDSVQIIIPQNQVKRKHD 331 >SPCC1223.06 |tea1|alp8|cell end marker Tea1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1147 Score = 26.2 bits (55), Expect = 4.8 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +1 Query: 256 AKIDDLTQKLTVANAD 303 +KID LT+KL VANA+ Sbjct: 621 SKIDSLTEKLKVANAE 636 >SPBC29A3.02c |his7||phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP pyrophosphohydrolase His7|Schizosaccharomyces pombe|chr 2|||Manual Length = 417 Score = 25.8 bits (54), Expect = 6.4 Identities = 13/47 (27%), Positives = 22/47 (46%) Frame = -3 Query: 548 RSFLRAQKRKLVVATSHTARLWHSCGLLGLAITSCAMSAMRLGQLRR 408 R+ + + +L AT+ +W L+ AIT C S + L + R Sbjct: 334 RAKIMEEAEELCDATTKENVIWEMADLMYFAITRCVGSGVSLNDISR 380 >SPAC3F10.09 |||1-|Schizosaccharomyces pombe|chr 1|||Manual Length = 264 Score = 25.8 bits (54), Expect = 6.4 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +1 Query: 529 CARKNDRWAAA*NDW 573 C RK++RW AA N W Sbjct: 140 CRRKDNRWFAAINKW 154 >SPAC17A5.15c |||glutamate-tRNA ligase |Schizosaccharomyces pombe|chr 1|||Manual Length = 716 Score = 25.4 bits (53), Expect = 8.5 Identities = 9/21 (42%), Positives = 17/21 (80%) Frame = +1 Query: 331 LFANEMIVARRDAETARQDCE 393 +FANE+++ + DA++ +QD E Sbjct: 556 IFANEILIEQADAQSFKQDEE 576 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,157,828 Number of Sequences: 5004 Number of extensions: 65084 Number of successful extensions: 169 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 167 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 169 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 347244562 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -