BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120218.Seq (638 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC405.01 |ade1|min4, SPBC4C3.02c|phosphoribosylamine-glycine l... 28 1.3 SPCC4G3.12c |||ubiquitin-protein ligase E3 |Schizosaccharomyces ... 25 7.0 >SPBC405.01 |ade1|min4, SPBC4C3.02c|phosphoribosylamine-glycine ligase |Schizosaccharomyces pombe|chr 2|||Manual Length = 788 Score = 27.9 bits (59), Expect = 1.3 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +2 Query: 419 ESLHFNVYSINRNVVDVIKCSVTSVAQWNK 508 + +H N YS+ R +V+ TSV W+K Sbjct: 619 DGVHSNGYSLVRKIVEYSDLEYTSVCPWDK 648 >SPCC4G3.12c |||ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 3|||Manual Length = 821 Score = 25.4 bits (53), Expect = 7.0 Identities = 10/33 (30%), Positives = 12/33 (36%) Frame = +2 Query: 329 ELDTCKHQLCSMCXXXXXXXXXXPCPLCRVESL 427 +L CKH C CPLCR + Sbjct: 781 KLQACKHFFHQACIDQWLTTGNNSCPLCRAHGV 813 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,224,482 Number of Sequences: 5004 Number of extensions: 39340 Number of successful extensions: 107 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 104 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 107 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 285732116 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -